Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q740

Protein Details
Accession S7Q740    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
96-115APKRKPTNPDVKKPNPSEKSHydrophilic
NLS Segment(s)
PositionSequence
89-136RKNVSSVAPKRKPTNPDVKKPNPSEKSKSEPGPASSKESKSKKDTNRK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_93389  -  
Amino Acid Sequences MATYFGDEEEGYMYDNKDEDEDDDRHVLPSSPSSRVDWSVDETGEVDEESEPEAEDWAKNVITGSWDDQKGRDAYPRGSNERGVGAPARKNVSSVAPKRKPTNPDVKKPNPSEKSKSEPGPASSKESKSKKDTNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.11
6 0.12
7 0.16
8 0.17
9 0.19
10 0.21
11 0.21
12 0.21
13 0.21
14 0.19
15 0.15
16 0.21
17 0.21
18 0.22
19 0.23
20 0.25
21 0.26
22 0.28
23 0.29
24 0.23
25 0.24
26 0.23
27 0.21
28 0.19
29 0.17
30 0.15
31 0.13
32 0.11
33 0.07
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.09
52 0.12
53 0.13
54 0.13
55 0.14
56 0.16
57 0.16
58 0.16
59 0.18
60 0.17
61 0.19
62 0.26
63 0.3
64 0.32
65 0.32
66 0.32
67 0.29
68 0.28
69 0.25
70 0.19
71 0.18
72 0.17
73 0.18
74 0.21
75 0.23
76 0.21
77 0.22
78 0.21
79 0.25
80 0.31
81 0.36
82 0.44
83 0.48
84 0.53
85 0.58
86 0.63
87 0.62
88 0.61
89 0.64
90 0.62
91 0.65
92 0.71
93 0.74
94 0.77
95 0.78
96 0.81
97 0.78
98 0.77
99 0.74
100 0.71
101 0.7
102 0.68
103 0.66
104 0.62
105 0.59
106 0.55
107 0.56
108 0.52
109 0.51
110 0.51
111 0.52
112 0.55
113 0.57
114 0.61
115 0.61
116 0.68