Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PRL4

Protein Details
Accession S7PRL4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-131LPTSPFRPSRRLRKAPKRPTSDVPHFHydrophilic
NLS Segment(s)
PositionSequence
114-123SRRLRKAPKR
Subcellular Location(s) cyto 8, nucl 7, cyto_mito 7, mito 6
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_134356  -  
Amino Acid Sequences MPIDTLVAVVRARASRDIEPQNAPAFWFSMSFMEKGAHICAPVLPQSSITGFTPPDPSPPIPPSPGCPLSSGRLRLGSTSSKTLTRASHYVALARRCCISFFVTLLPTSPFRPSRRLRKAPKRPTSDVPHFIHAVGSATGCSSLSGPPPPPPSSPSPSPPVSFKPTSKCNAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.33
4 0.39
5 0.4
6 0.41
7 0.42
8 0.41
9 0.37
10 0.34
11 0.27
12 0.21
13 0.17
14 0.15
15 0.12
16 0.13
17 0.14
18 0.14
19 0.14
20 0.13
21 0.13
22 0.14
23 0.15
24 0.12
25 0.11
26 0.11
27 0.11
28 0.12
29 0.14
30 0.15
31 0.13
32 0.13
33 0.14
34 0.15
35 0.16
36 0.14
37 0.14
38 0.12
39 0.13
40 0.16
41 0.15
42 0.17
43 0.19
44 0.2
45 0.23
46 0.26
47 0.27
48 0.26
49 0.26
50 0.27
51 0.3
52 0.31
53 0.27
54 0.26
55 0.26
56 0.27
57 0.31
58 0.3
59 0.24
60 0.24
61 0.23
62 0.22
63 0.23
64 0.22
65 0.2
66 0.2
67 0.2
68 0.18
69 0.2
70 0.22
71 0.2
72 0.2
73 0.19
74 0.18
75 0.21
76 0.2
77 0.23
78 0.24
79 0.27
80 0.25
81 0.24
82 0.23
83 0.2
84 0.2
85 0.18
86 0.16
87 0.13
88 0.13
89 0.14
90 0.13
91 0.13
92 0.13
93 0.13
94 0.12
95 0.13
96 0.17
97 0.2
98 0.22
99 0.31
100 0.38
101 0.47
102 0.57
103 0.66
104 0.72
105 0.78
106 0.86
107 0.89
108 0.91
109 0.88
110 0.83
111 0.82
112 0.8
113 0.77
114 0.75
115 0.67
116 0.6
117 0.52
118 0.47
119 0.38
120 0.29
121 0.22
122 0.14
123 0.11
124 0.08
125 0.08
126 0.08
127 0.07
128 0.07
129 0.07
130 0.08
131 0.11
132 0.14
133 0.16
134 0.22
135 0.28
136 0.3
137 0.32
138 0.35
139 0.39
140 0.43
141 0.46
142 0.45
143 0.46
144 0.47
145 0.48
146 0.48
147 0.47
148 0.48
149 0.48
150 0.48
151 0.5
152 0.54
153 0.57