Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RZM1

Protein Details
Accession S7RZM1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
246-288YEGPRDRRPPPPRRGESPPAYRGRGRGRRSRSRSRSPPPHRRRBasic
NLS Segment(s)
PositionSequence
220-288RGESNGPPARGGRGGGRGDFANRDREYEGPRDRRPPPPRRGESPPAYRGRGRGRRSRSRSRSPPPHRRR
Subcellular Location(s) cyto 13, nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
KEGG gtr:GLOTRDRAFT_135912  -  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MEDTVTPAGRPIVDREKTAPFLIRTFIKIGSFHRLNVFEDGALPTTDEQQIYTWKDATLGEVLTTLRNTAPQTPEYRHPLARYSFRAVYADSASRGRFAQKDLGIVYSRDILGEPGSLDHPAPRLTEDARAELSDREKEERTLDELRFVPGDYMCVAVILPKNVTVPGAGGELAVKGAGAAAAAAANGWKGAGGAGRGGDAGWGGSLAPVGAGRGGGHWRGESNGPPARGGRGGGRGDFANRDREYEGPRDRRPPPPRRGESPPAYRGRGRGRRSRSRSRSPPPHRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.41
4 0.42
5 0.43
6 0.42
7 0.34
8 0.33
9 0.35
10 0.33
11 0.3
12 0.29
13 0.29
14 0.26
15 0.26
16 0.27
17 0.33
18 0.32
19 0.31
20 0.34
21 0.34
22 0.34
23 0.35
24 0.33
25 0.23
26 0.23
27 0.22
28 0.18
29 0.16
30 0.14
31 0.11
32 0.13
33 0.15
34 0.13
35 0.12
36 0.13
37 0.18
38 0.21
39 0.23
40 0.21
41 0.19
42 0.2
43 0.2
44 0.2
45 0.17
46 0.13
47 0.11
48 0.11
49 0.12
50 0.11
51 0.11
52 0.1
53 0.08
54 0.11
55 0.12
56 0.16
57 0.19
58 0.22
59 0.26
60 0.29
61 0.36
62 0.4
63 0.42
64 0.4
65 0.39
66 0.41
67 0.41
68 0.43
69 0.42
70 0.41
71 0.38
72 0.37
73 0.36
74 0.31
75 0.28
76 0.25
77 0.21
78 0.17
79 0.17
80 0.16
81 0.16
82 0.16
83 0.17
84 0.15
85 0.16
86 0.21
87 0.2
88 0.22
89 0.21
90 0.23
91 0.21
92 0.2
93 0.19
94 0.13
95 0.12
96 0.1
97 0.1
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.09
109 0.09
110 0.09
111 0.1
112 0.11
113 0.16
114 0.16
115 0.16
116 0.16
117 0.16
118 0.16
119 0.15
120 0.17
121 0.14
122 0.15
123 0.16
124 0.16
125 0.17
126 0.18
127 0.17
128 0.19
129 0.21
130 0.2
131 0.2
132 0.2
133 0.2
134 0.18
135 0.17
136 0.14
137 0.09
138 0.1
139 0.07
140 0.07
141 0.06
142 0.06
143 0.05
144 0.07
145 0.08
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.03
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.03
179 0.04
180 0.04
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.05
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.05
202 0.08
203 0.09
204 0.1
205 0.11
206 0.11
207 0.13
208 0.15
209 0.17
210 0.21
211 0.25
212 0.25
213 0.26
214 0.26
215 0.26
216 0.26
217 0.24
218 0.21
219 0.24
220 0.25
221 0.24
222 0.25
223 0.23
224 0.24
225 0.29
226 0.27
227 0.28
228 0.26
229 0.29
230 0.29
231 0.31
232 0.34
233 0.38
234 0.45
235 0.46
236 0.51
237 0.56
238 0.59
239 0.66
240 0.72
241 0.73
242 0.74
243 0.77
244 0.78
245 0.78
246 0.82
247 0.81
248 0.8
249 0.79
250 0.77
251 0.73
252 0.71
253 0.66
254 0.65
255 0.66
256 0.66
257 0.65
258 0.66
259 0.69
260 0.75
261 0.81
262 0.85
263 0.84
264 0.85
265 0.88
266 0.89
267 0.91
268 0.91