Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RNQ5

Protein Details
Accession S7RNQ5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-65PSPNPAPSTPRRHVRKRRSSLSLNVHydrophilic
NLS Segment(s)
PositionSequence
55-56RK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_137965  -  
Amino Acid Sequences MAYSPARSRSSSPSPSPSPLPPTPSFSFPAPSTSGCQPPPPSPNPAPSTPRRHVRKRRSSLSLNVSSINASLGQLKSPQRSVDIAMQRQRQLLVSMSPGRSRSATVAEGAMGRIKEEGSPSGRARASTLFVPARGAMPVLRTRRKLRLQLAPALPPPNSPLPPIPSQQAPASLNRQPFAPSCSPNALPVDSPVTLDSNFTDKLFSAMSMSQSPIEQERAQWDMEAENGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.58
4 0.54
5 0.53
6 0.49
7 0.51
8 0.45
9 0.48
10 0.47
11 0.46
12 0.44
13 0.37
14 0.38
15 0.32
16 0.33
17 0.28
18 0.27
19 0.28
20 0.29
21 0.33
22 0.29
23 0.34
24 0.34
25 0.37
26 0.43
27 0.42
28 0.46
29 0.44
30 0.5
31 0.5
32 0.52
33 0.53
34 0.54
35 0.6
36 0.59
37 0.65
38 0.66
39 0.72
40 0.77
41 0.81
42 0.84
43 0.85
44 0.86
45 0.84
46 0.81
47 0.78
48 0.76
49 0.71
50 0.61
51 0.52
52 0.44
53 0.37
54 0.31
55 0.23
56 0.14
57 0.08
58 0.1
59 0.09
60 0.1
61 0.15
62 0.18
63 0.2
64 0.21
65 0.21
66 0.2
67 0.21
68 0.23
69 0.26
70 0.29
71 0.32
72 0.37
73 0.4
74 0.39
75 0.38
76 0.36
77 0.29
78 0.24
79 0.19
80 0.14
81 0.15
82 0.18
83 0.18
84 0.19
85 0.19
86 0.19
87 0.18
88 0.18
89 0.15
90 0.14
91 0.14
92 0.12
93 0.12
94 0.11
95 0.11
96 0.1
97 0.1
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.09
105 0.1
106 0.14
107 0.14
108 0.19
109 0.19
110 0.19
111 0.19
112 0.18
113 0.18
114 0.14
115 0.18
116 0.14
117 0.14
118 0.15
119 0.14
120 0.13
121 0.11
122 0.11
123 0.07
124 0.09
125 0.15
126 0.21
127 0.26
128 0.3
129 0.35
130 0.43
131 0.49
132 0.54
133 0.55
134 0.58
135 0.57
136 0.6
137 0.59
138 0.53
139 0.5
140 0.44
141 0.37
142 0.28
143 0.28
144 0.24
145 0.22
146 0.21
147 0.21
148 0.24
149 0.27
150 0.29
151 0.28
152 0.24
153 0.26
154 0.25
155 0.27
156 0.24
157 0.25
158 0.29
159 0.3
160 0.31
161 0.29
162 0.28
163 0.25
164 0.25
165 0.28
166 0.28
167 0.26
168 0.28
169 0.32
170 0.32
171 0.33
172 0.34
173 0.29
174 0.24
175 0.24
176 0.24
177 0.19
178 0.19
179 0.17
180 0.16
181 0.15
182 0.16
183 0.15
184 0.15
185 0.16
186 0.15
187 0.15
188 0.13
189 0.15
190 0.14
191 0.13
192 0.12
193 0.13
194 0.16
195 0.17
196 0.18
197 0.17
198 0.17
199 0.19
200 0.19
201 0.22
202 0.2
203 0.2
204 0.24
205 0.25
206 0.25
207 0.23
208 0.21
209 0.17