Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RL22

Protein Details
Accession S7RL22    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
225-253ISALWRTKQKGQRRKGAKDKGKRQGKGKGBasic
NLS Segment(s)
PositionSequence
231-258TKQKGQRRKGAKDKGKRQGKGKGKGRGK
Subcellular Location(s) cyto 12.5, cyto_nucl 9.5, mito 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG gtr:GLOTRDRAFT_111949  -  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50103  ZF_C3H1  
Amino Acid Sequences MYEMAEEAATSALKFDPGWTKARYRRGLARKGMEDYAAAMMDFHVVLKLDPSCADAQKEHDIVADLCMGDWDHDADYIYPPPDEHLWQNWEEGSDSSDFNHEGSNIPCRWYNRDGCKKGRECPYSHAPDAKSVRDKLGRNVCVFHVMNKCKFGETRCVYSHDLRYLPDSWAAFIKDKGRVRDFWELYLEYQRVPDGTFAPWAEPKREQWLPEYCRRSVEEIPDDISALWRTKQKGQRRKGAKDKGKRQGKGKGKGRGKDTGGWEEFLRKAYWDHELEREAAERADNYGFTRAEVDDLLCQGVKPWDEDAWDVMQVLNGDFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.19
4 0.22
5 0.28
6 0.31
7 0.4
8 0.47
9 0.57
10 0.6
11 0.58
12 0.65
13 0.7
14 0.76
15 0.75
16 0.76
17 0.7
18 0.68
19 0.63
20 0.54
21 0.44
22 0.36
23 0.29
24 0.2
25 0.15
26 0.1
27 0.09
28 0.09
29 0.09
30 0.07
31 0.06
32 0.06
33 0.06
34 0.09
35 0.1
36 0.1
37 0.1
38 0.13
39 0.15
40 0.17
41 0.2
42 0.19
43 0.23
44 0.28
45 0.28
46 0.25
47 0.23
48 0.23
49 0.2
50 0.2
51 0.17
52 0.11
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.12
65 0.13
66 0.12
67 0.11
68 0.13
69 0.14
70 0.16
71 0.17
72 0.19
73 0.22
74 0.23
75 0.24
76 0.22
77 0.21
78 0.19
79 0.17
80 0.14
81 0.12
82 0.11
83 0.1
84 0.12
85 0.11
86 0.1
87 0.11
88 0.09
89 0.1
90 0.11
91 0.17
92 0.16
93 0.18
94 0.21
95 0.22
96 0.27
97 0.32
98 0.38
99 0.42
100 0.53
101 0.58
102 0.61
103 0.69
104 0.67
105 0.68
106 0.7
107 0.64
108 0.56
109 0.56
110 0.58
111 0.55
112 0.53
113 0.5
114 0.41
115 0.44
116 0.44
117 0.42
118 0.37
119 0.32
120 0.35
121 0.36
122 0.37
123 0.38
124 0.44
125 0.43
126 0.39
127 0.4
128 0.35
129 0.36
130 0.34
131 0.32
132 0.31
133 0.31
134 0.32
135 0.33
136 0.33
137 0.27
138 0.29
139 0.25
140 0.27
141 0.26
142 0.3
143 0.29
144 0.33
145 0.34
146 0.36
147 0.37
148 0.3
149 0.27
150 0.22
151 0.24
152 0.21
153 0.19
154 0.18
155 0.15
156 0.13
157 0.14
158 0.15
159 0.13
160 0.13
161 0.15
162 0.2
163 0.23
164 0.27
165 0.28
166 0.29
167 0.33
168 0.41
169 0.39
170 0.33
171 0.33
172 0.29
173 0.28
174 0.3
175 0.25
176 0.16
177 0.15
178 0.14
179 0.11
180 0.11
181 0.11
182 0.08
183 0.09
184 0.11
185 0.11
186 0.12
187 0.16
188 0.17
189 0.19
190 0.2
191 0.21
192 0.26
193 0.28
194 0.28
195 0.29
196 0.37
197 0.4
198 0.46
199 0.49
200 0.43
201 0.43
202 0.44
203 0.44
204 0.38
205 0.39
206 0.34
207 0.31
208 0.32
209 0.29
210 0.28
211 0.22
212 0.21
213 0.16
214 0.13
215 0.14
216 0.16
217 0.19
218 0.28
219 0.36
220 0.45
221 0.53
222 0.61
223 0.68
224 0.73
225 0.81
226 0.83
227 0.85
228 0.85
229 0.86
230 0.88
231 0.88
232 0.88
233 0.84
234 0.8
235 0.8
236 0.8
237 0.79
238 0.78
239 0.78
240 0.76
241 0.77
242 0.74
243 0.72
244 0.66
245 0.62
246 0.58
247 0.57
248 0.5
249 0.46
250 0.41
251 0.37
252 0.35
253 0.31
254 0.25
255 0.17
256 0.17
257 0.18
258 0.24
259 0.24
260 0.25
261 0.28
262 0.29
263 0.3
264 0.3
265 0.29
266 0.23
267 0.2
268 0.19
269 0.14
270 0.15
271 0.15
272 0.14
273 0.15
274 0.19
275 0.19
276 0.18
277 0.2
278 0.17
279 0.18
280 0.18
281 0.17
282 0.14
283 0.14
284 0.15
285 0.13
286 0.12
287 0.13
288 0.17
289 0.17
290 0.17
291 0.18
292 0.19
293 0.2
294 0.22
295 0.23
296 0.21
297 0.2
298 0.18
299 0.16
300 0.16
301 0.15