Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q168

Protein Details
Accession S7Q168    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-131RSATERHRPMPPRRPSNFRRPKYBasic
NLS Segment(s)
PositionSequence
117-124PMPPRRPS
Subcellular Location(s) cyto 13.5, cyto_nucl 11.833, cyto_mito 10.832, mito 6.5, nucl 6
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_45115  -  
Amino Acid Sequences MPVYPSDKAAVEHVSVVDLNDTTPNPRRFALARIRGEVQLVEGSAASALAVVDVDIFRHEFISIFRYSHSTSLHPSDIHIIEPIAPEHVLYEEENGTAFLAKNVMERLRSATERHRPMPPRRPSNFRRPKYLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.12
5 0.09
6 0.09
7 0.1
8 0.1
9 0.14
10 0.23
11 0.25
12 0.27
13 0.27
14 0.3
15 0.29
16 0.36
17 0.42
18 0.42
19 0.43
20 0.44
21 0.46
22 0.43
23 0.42
24 0.34
25 0.25
26 0.16
27 0.13
28 0.09
29 0.07
30 0.07
31 0.06
32 0.05
33 0.04
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.09
50 0.09
51 0.09
52 0.1
53 0.12
54 0.13
55 0.15
56 0.16
57 0.13
58 0.15
59 0.18
60 0.19
61 0.17
62 0.16
63 0.18
64 0.17
65 0.16
66 0.14
67 0.11
68 0.1
69 0.11
70 0.1
71 0.07
72 0.07
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.07
89 0.08
90 0.11
91 0.13
92 0.13
93 0.14
94 0.19
95 0.23
96 0.25
97 0.27
98 0.34
99 0.42
100 0.48
101 0.51
102 0.55
103 0.59
104 0.67
105 0.74
106 0.75
107 0.76
108 0.75
109 0.82
110 0.8
111 0.83
112 0.84
113 0.79