Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RCX4

Protein Details
Accession S7RCX4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-102DDAPKPKARKRDDARGRGRGRBasic
NLS Segment(s)
PositionSequence
85-116PKPKARKRDDARGRGRGRGDRGRVRGRGRGRG
Subcellular Location(s) nucl 16, cyto_nucl 13.333, cyto 8.5, cyto_pero 5.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0006364  P:rRNA processing  
GO:0000387  P:spliceosomal snRNP assembly  
KEGG gtr:GLOTRDRAFT_117569  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKLNNETVTIELKNGSIVHGTITGVDMQMNTHLKTVKMTARNREPTTLDSLSIRGNNIRYFILPDALPVDTLLVDDAPKPKARKRDDARGRGRGRGDRGRVRGRGRGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.19
4 0.17
5 0.15
6 0.13
7 0.14
8 0.13
9 0.12
10 0.1
11 0.09
12 0.1
13 0.1
14 0.1
15 0.08
16 0.09
17 0.08
18 0.07
19 0.07
20 0.06
21 0.05
22 0.1
23 0.12
24 0.11
25 0.13
26 0.14
27 0.14
28 0.15
29 0.19
30 0.2
31 0.26
32 0.3
33 0.36
34 0.44
35 0.51
36 0.52
37 0.51
38 0.46
39 0.4
40 0.43
41 0.35
42 0.27
43 0.2
44 0.19
45 0.18
46 0.17
47 0.15
48 0.1
49 0.11
50 0.11
51 0.13
52 0.12
53 0.11
54 0.13
55 0.13
56 0.13
57 0.11
58 0.11
59 0.11
60 0.11
61 0.1
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.04
68 0.04
69 0.06
70 0.09
71 0.11
72 0.16
73 0.2
74 0.24
75 0.34
76 0.4
77 0.5
78 0.55
79 0.64
80 0.7
81 0.77
82 0.81
83 0.82
84 0.79
85 0.74
86 0.73
87 0.69
88 0.67
89 0.66
90 0.66
91 0.65
92 0.7
93 0.73
94 0.74
95 0.72
96 0.73