Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2V3N1

Protein Details
Accession A0A0A2V3N1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-142GICERKTKSRGLQRRKRIDYGRTBasic
NLS Segment(s)
PositionSequence
125-136KTKSRGLQRRKR
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, cyto 8.5, mito 6
Family & Domain DBs
KEGG pbl:PAAG_12599  -  
Amino Acid Sequences MTEKALDESAKTVPDEIISRNAVDMYSSEGTVNDKALVWKQDLRIRWIALPTLSWGAVASGLGCANNYANATVLRLLPGMSEADLFAGDWLFTLSSGVKHQNAQGVLSGNSHVAVSDRKGICERKTKSRGLQRRKRIDYGRTLKRPSLTGVSIPTMPYALSTIYFTYHGSLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.2
5 0.2
6 0.2
7 0.19
8 0.19
9 0.16
10 0.15
11 0.13
12 0.13
13 0.13
14 0.13
15 0.13
16 0.13
17 0.16
18 0.16
19 0.16
20 0.11
21 0.1
22 0.12
23 0.16
24 0.17
25 0.18
26 0.21
27 0.25
28 0.3
29 0.31
30 0.35
31 0.36
32 0.35
33 0.34
34 0.31
35 0.28
36 0.23
37 0.21
38 0.18
39 0.15
40 0.14
41 0.11
42 0.1
43 0.08
44 0.08
45 0.07
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.07
84 0.09
85 0.1
86 0.11
87 0.12
88 0.16
89 0.16
90 0.15
91 0.15
92 0.14
93 0.14
94 0.14
95 0.13
96 0.09
97 0.09
98 0.09
99 0.07
100 0.06
101 0.07
102 0.08
103 0.16
104 0.16
105 0.17
106 0.22
107 0.26
108 0.31
109 0.39
110 0.43
111 0.45
112 0.52
113 0.56
114 0.6
115 0.67
116 0.73
117 0.74
118 0.79
119 0.79
120 0.84
121 0.85
122 0.84
123 0.81
124 0.78
125 0.77
126 0.77
127 0.77
128 0.75
129 0.73
130 0.68
131 0.63
132 0.58
133 0.51
134 0.47
135 0.39
136 0.33
137 0.32
138 0.31
139 0.29
140 0.28
141 0.24
142 0.18
143 0.15
144 0.13
145 0.11
146 0.09
147 0.09
148 0.1
149 0.11
150 0.12
151 0.13
152 0.13
153 0.14