Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q7A1

Protein Details
Accession S7Q7A1    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-33PSRTRDPGPSTQPKPKKARRPKAYHGQDEPTHydrophilic
NLS Segment(s)
PositionSequence
15-24PKPKKARRPK
84-87KERA
90-120VRYHKVKFFERQKVVRKIAQTKKKLARDGLR
170-231KEKAKTDKRRAELRARIRREMEAGELGGEPELEKGGRARSDHERSRGEGRKGGEKRGRAEKK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
KEGG gtr:GLOTRDRAFT_116299  -  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAPSRTRDPGPSTQPKPKKARRPKAYHGQDEPTGVPGVQKLKAQLRSVRRLLAKDNLAADVRVETERRLRALEADLEAAERARKERALAVRYHKVKFFERQKVVRKIAQTKKKLARDGLRGSERKELEGALAELRVDLNYILHYPRLEKYISLFPPEVRLGEVPPPEQAKEKAKTDKRRAELRARIRREMEAGELGGEPELEKGGRARSDHERSRGEGRKGGEKRGRAEKKGMEDDFFAGDEETDGGGGDSGSEFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.82
4 0.83
5 0.85
6 0.86
7 0.9
8 0.9
9 0.91
10 0.91
11 0.91
12 0.91
13 0.89
14 0.84
15 0.78
16 0.7
17 0.63
18 0.54
19 0.45
20 0.36
21 0.26
22 0.21
23 0.18
24 0.19
25 0.18
26 0.19
27 0.22
28 0.29
29 0.36
30 0.4
31 0.44
32 0.49
33 0.56
34 0.57
35 0.58
36 0.54
37 0.51
38 0.51
39 0.5
40 0.45
41 0.39
42 0.37
43 0.33
44 0.3
45 0.27
46 0.23
47 0.16
48 0.14
49 0.13
50 0.13
51 0.12
52 0.17
53 0.2
54 0.2
55 0.21
56 0.2
57 0.2
58 0.23
59 0.23
60 0.18
61 0.17
62 0.16
63 0.15
64 0.14
65 0.12
66 0.11
67 0.09
68 0.09
69 0.1
70 0.1
71 0.11
72 0.17
73 0.24
74 0.26
75 0.31
76 0.36
77 0.43
78 0.48
79 0.48
80 0.45
81 0.42
82 0.42
83 0.46
84 0.48
85 0.5
86 0.52
87 0.58
88 0.65
89 0.7
90 0.7
91 0.64
92 0.61
93 0.61
94 0.63
95 0.65
96 0.6
97 0.61
98 0.66
99 0.68
100 0.66
101 0.62
102 0.59
103 0.57
104 0.57
105 0.55
106 0.53
107 0.49
108 0.47
109 0.48
110 0.41
111 0.34
112 0.29
113 0.23
114 0.16
115 0.15
116 0.13
117 0.07
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.03
126 0.04
127 0.05
128 0.05
129 0.06
130 0.07
131 0.08
132 0.09
133 0.11
134 0.11
135 0.11
136 0.14
137 0.21
138 0.21
139 0.23
140 0.23
141 0.21
142 0.24
143 0.25
144 0.22
145 0.15
146 0.15
147 0.13
148 0.17
149 0.18
150 0.15
151 0.17
152 0.18
153 0.18
154 0.2
155 0.23
156 0.25
157 0.29
158 0.34
159 0.41
160 0.49
161 0.58
162 0.66
163 0.71
164 0.7
165 0.74
166 0.74
167 0.74
168 0.75
169 0.75
170 0.76
171 0.73
172 0.72
173 0.65
174 0.61
175 0.53
176 0.45
177 0.37
178 0.28
179 0.23
180 0.18
181 0.16
182 0.14
183 0.12
184 0.1
185 0.07
186 0.06
187 0.06
188 0.05
189 0.06
190 0.07
191 0.11
192 0.15
193 0.15
194 0.2
195 0.29
196 0.38
197 0.45
198 0.5
199 0.49
200 0.5
201 0.59
202 0.63
203 0.57
204 0.53
205 0.5
206 0.53
207 0.53
208 0.59
209 0.56
210 0.53
211 0.56
212 0.62
213 0.67
214 0.61
215 0.66
216 0.62
217 0.64
218 0.68
219 0.63
220 0.54
221 0.48
222 0.45
223 0.39
224 0.33
225 0.24
226 0.15
227 0.13
228 0.12
229 0.1
230 0.09
231 0.07
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06