Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q409

Protein Details
Accession S7Q409    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-85EVYSRVPRKTKHKKADDLARKQAEHydrophilic
NLS Segment(s)
PositionSequence
70-74KTKHK
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_17563  -  
Amino Acid Sequences MSSDLHTYISDNVIQFFGLSDKAIIDYIIASASSAKSAESLFSTLSAYGLPATPAAQNFVTEVYSRVPRKTKHKKADDLARKQAEKESQALRTQKYSFVLDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.1
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.05
17 0.04
18 0.05
19 0.05
20 0.06
21 0.06
22 0.05
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.07
29 0.08
30 0.08
31 0.07
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.06
41 0.06
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.16
52 0.17
53 0.21
54 0.26
55 0.31
56 0.42
57 0.52
58 0.6
59 0.65
60 0.73
61 0.77
62 0.8
63 0.86
64 0.86
65 0.83
66 0.82
67 0.79
68 0.7
69 0.63
70 0.6
71 0.55
72 0.47
73 0.44
74 0.4
75 0.37
76 0.43
77 0.47
78 0.44
79 0.45
80 0.44
81 0.42
82 0.41
83 0.39