Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q232

Protein Details
Accession S7Q232    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-104NSITRARWIRPIHRRKPNQRVAHAILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_23787  -  
Amino Acid Sequences IAAASKISTGGILYEVRTREGADYLRQNSGAFEERYHPTAVIRDRQPCPVLAEFVPIQFDPDRPDDLREIEEVNEYEPNSITRARWIRPIHRRKPNQRVAHAILYFRDPQTANSAITS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.17
5 0.17
6 0.16
7 0.18
8 0.19
9 0.2
10 0.27
11 0.28
12 0.29
13 0.29
14 0.28
15 0.25
16 0.26
17 0.25
18 0.19
19 0.18
20 0.2
21 0.21
22 0.24
23 0.24
24 0.2
25 0.16
26 0.21
27 0.23
28 0.26
29 0.28
30 0.33
31 0.34
32 0.38
33 0.38
34 0.33
35 0.33
36 0.27
37 0.25
38 0.19
39 0.2
40 0.16
41 0.16
42 0.16
43 0.11
44 0.13
45 0.11
46 0.11
47 0.11
48 0.12
49 0.15
50 0.14
51 0.16
52 0.15
53 0.16
54 0.17
55 0.15
56 0.14
57 0.12
58 0.13
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.17
70 0.22
71 0.23
72 0.31
73 0.36
74 0.44
75 0.54
76 0.65
77 0.67
78 0.73
79 0.82
80 0.84
81 0.9
82 0.9
83 0.89
84 0.84
85 0.82
86 0.78
87 0.75
88 0.67
89 0.57
90 0.49
91 0.43
92 0.4
93 0.32
94 0.3
95 0.23
96 0.22
97 0.27
98 0.28