Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7PPK6

Protein Details
Accession S7PPK6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-54ISNKIKFRKILKKLFRKATIRHydrophilic
NLS Segment(s)
PositionSequence
39-51KFRKILKKLFRKA
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036419  Ribosomal_S3_C_sf  
IPR007980  Ribosomal_VAR1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_9018  -  
Pfam View protein in Pfam  
PF05316  VAR1  
Amino Acid Sequences ILSRIFNKPVELELIRLYRPYFDSNILVNTIGLISNKIKFRKILKKLFRKATIRNNKKTNNLLPSFLSGIQIRVAGRLLTNRVIPRMTVKNYQKGRLARSKATLVDTSRFTRKNKRGTFSITV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.26
4 0.24
5 0.21
6 0.23
7 0.24
8 0.21
9 0.21
10 0.23
11 0.23
12 0.24
13 0.23
14 0.2
15 0.16
16 0.14
17 0.11
18 0.09
19 0.08
20 0.09
21 0.09
22 0.14
23 0.19
24 0.2
25 0.22
26 0.25
27 0.34
28 0.42
29 0.5
30 0.56
31 0.61
32 0.7
33 0.77
34 0.81
35 0.81
36 0.76
37 0.74
38 0.75
39 0.76
40 0.74
41 0.74
42 0.74
43 0.7
44 0.7
45 0.69
46 0.63
47 0.6
48 0.52
49 0.45
50 0.37
51 0.34
52 0.3
53 0.24
54 0.21
55 0.13
56 0.12
57 0.11
58 0.11
59 0.1
60 0.09
61 0.09
62 0.07
63 0.08
64 0.09
65 0.11
66 0.12
67 0.15
68 0.16
69 0.17
70 0.17
71 0.17
72 0.21
73 0.26
74 0.28
75 0.34
76 0.38
77 0.46
78 0.5
79 0.54
80 0.55
81 0.53
82 0.56
83 0.57
84 0.57
85 0.52
86 0.53
87 0.53
88 0.49
89 0.48
90 0.45
91 0.39
92 0.37
93 0.37
94 0.37
95 0.41
96 0.43
97 0.44
98 0.5
99 0.56
100 0.63
101 0.67
102 0.69
103 0.67