Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q1C9

Protein Details
Accession S7Q1C9    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ETPLKPTSHRLNPKVHREQLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 9.5, mito 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013096  Cupin_2  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
KEGG gtr:GLOTRDRAFT_111776  -  
Pfam View protein in Pfam  
PF07883  Cupin_2  
CDD cd02224  cupin_SPO2919-like  
Amino Acid Sequences MSSEQKPYVIHTKETPLKPTSHRLNPKVHREQLRLGDLTGLTKTGVHLCRVPPHNDSTVLHWHSNEDEWVYIVSAGAGAVMRIKEGDKEVEHVPIKEGDFFGFPAGSRNAHALKSGEGEIVYLVGGSRETLDVCTYPEVNVRGVLDRTPGGKSWDVGEEAVVQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.46
4 0.48
5 0.49
6 0.55
7 0.55
8 0.56
9 0.62
10 0.63
11 0.7
12 0.74
13 0.8
14 0.8
15 0.79
16 0.77
17 0.72
18 0.73
19 0.69
20 0.66
21 0.56
22 0.46
23 0.4
24 0.32
25 0.29
26 0.22
27 0.15
28 0.1
29 0.09
30 0.1
31 0.14
32 0.15
33 0.16
34 0.18
35 0.2
36 0.28
37 0.32
38 0.34
39 0.31
40 0.33
41 0.33
42 0.33
43 0.32
44 0.29
45 0.33
46 0.32
47 0.3
48 0.27
49 0.25
50 0.23
51 0.23
52 0.19
53 0.11
54 0.08
55 0.08
56 0.08
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.02
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.06
73 0.08
74 0.08
75 0.11
76 0.12
77 0.17
78 0.18
79 0.17
80 0.17
81 0.17
82 0.17
83 0.15
84 0.15
85 0.1
86 0.1
87 0.1
88 0.1
89 0.08
90 0.07
91 0.09
92 0.1
93 0.1
94 0.1
95 0.13
96 0.15
97 0.15
98 0.17
99 0.14
100 0.14
101 0.16
102 0.16
103 0.13
104 0.11
105 0.11
106 0.09
107 0.08
108 0.07
109 0.05
110 0.04
111 0.03
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.07
118 0.08
119 0.09
120 0.1
121 0.13
122 0.12
123 0.13
124 0.17
125 0.18
126 0.17
127 0.18
128 0.18
129 0.19
130 0.2
131 0.2
132 0.18
133 0.18
134 0.19
135 0.2
136 0.2
137 0.22
138 0.23
139 0.23
140 0.23
141 0.24
142 0.24
143 0.22
144 0.22