Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7QCD1

Protein Details
Accession S7QCD1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-96DVRCSSAWTKTRRRWWVRKRNGKILKHydrophilic
NLS Segment(s)
PositionSequence
82-96RRRWWVRKRNGKILK
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_110619  -  
Amino Acid Sequences MPIYRITYLATHYAPFLYAKPYTYIPSLSLSLLPNQIFDTCTAREQQQHSKDRLRDSGVDLMMAMGLDLGDVRCSSAWTKTRRRWWVRKRNGKILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.14
5 0.14
6 0.15
7 0.17
8 0.18
9 0.2
10 0.2
11 0.2
12 0.17
13 0.19
14 0.19
15 0.17
16 0.17
17 0.16
18 0.16
19 0.18
20 0.17
21 0.14
22 0.14
23 0.14
24 0.12
25 0.12
26 0.14
27 0.12
28 0.13
29 0.14
30 0.14
31 0.18
32 0.21
33 0.29
34 0.34
35 0.39
36 0.42
37 0.47
38 0.49
39 0.48
40 0.47
41 0.42
42 0.34
43 0.32
44 0.33
45 0.27
46 0.23
47 0.19
48 0.16
49 0.13
50 0.11
51 0.08
52 0.03
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.07
62 0.08
63 0.16
64 0.23
65 0.31
66 0.41
67 0.49
68 0.6
69 0.69
70 0.78
71 0.82
72 0.86
73 0.89
74 0.91
75 0.93
76 0.92