Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7R9T4

Protein Details
Accession S7R9T4    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-44AANTKKGRRHAPPKKIQAVQHydrophilic
NLS Segment(s)
PositionSequence
17-39AARHSAKAAANTKKGRRHAPPKK
93-97KKKAK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG gtr:GLOTRDRAFT_66165  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGKTKGLAQKASGSAARHSAKAAANTKKGRRHAPPKKIQAVQQAAMHKKLSAKINNSIEQQMVAAASSGKLTIMKNASLETSESSTKAAIKKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.3
4 0.33
5 0.33
6 0.27
7 0.26
8 0.26
9 0.26
10 0.31
11 0.37
12 0.36
13 0.42
14 0.49
15 0.55
16 0.58
17 0.61
18 0.61
19 0.63
20 0.68
21 0.7
22 0.73
23 0.76
24 0.78
25 0.81
26 0.76
27 0.71
28 0.69
29 0.63
30 0.54
31 0.48
32 0.45
33 0.38
34 0.37
35 0.33
36 0.25
37 0.22
38 0.24
39 0.26
40 0.26
41 0.28
42 0.34
43 0.39
44 0.41
45 0.41
46 0.38
47 0.32
48 0.27
49 0.23
50 0.15
51 0.1
52 0.07
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.07
60 0.07
61 0.12
62 0.14
63 0.15
64 0.16
65 0.17
66 0.17
67 0.16
68 0.17
69 0.15
70 0.16
71 0.16
72 0.16
73 0.16
74 0.17
75 0.2
76 0.25
77 0.3