Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RTM8

Protein Details
Accession S7RTM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-62QELAKWKWSRWQQEREERLRANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
KEGG gtr:GLOTRDRAFT_36480  -  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MPPVLLSRALDPLLGVFTGLTAYYLYETHPRTAPPPGERLQELAKWKWSRWQQEREERLRANEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.12
14 0.13
15 0.15
16 0.16
17 0.16
18 0.17
19 0.21
20 0.24
21 0.2
22 0.24
23 0.25
24 0.26
25 0.26
26 0.27
27 0.26
28 0.26
29 0.29
30 0.26
31 0.32
32 0.32
33 0.32
34 0.38
35 0.44
36 0.5
37 0.55
38 0.62
39 0.64
40 0.73
41 0.82
42 0.8
43 0.81
44 0.73