Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7QJ48

Protein Details
Accession S7QJ48    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-36SSSGGGKSAKKKKWSKGKVKDKATHAVHydrophilic
NLS Segment(s)
PositionSequence
10-31SSSGGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG gtr:GLOTRDRAFT_109812  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPSSSGGGKSAKKKKWSKGKVKDKATHAVALDKATYDRIMKEVPTFRFISQSILIERLKVNGSLARRAIAHLEKEGQIKRIVHHSSQLIYTRLTTASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.33
4 0.41
5 0.46
6 0.53
7 0.62
8 0.7
9 0.77
10 0.82
11 0.83
12 0.85
13 0.89
14 0.89
15 0.9
16 0.88
17 0.81
18 0.79
19 0.7
20 0.62
21 0.51
22 0.44
23 0.35
24 0.29
25 0.24
26 0.16
27 0.14
28 0.11
29 0.12
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.14
36 0.19
37 0.19
38 0.22
39 0.23
40 0.21
41 0.23
42 0.23
43 0.22
44 0.18
45 0.18
46 0.15
47 0.18
48 0.17
49 0.16
50 0.16
51 0.14
52 0.14
53 0.12
54 0.13
55 0.12
56 0.15
57 0.18
58 0.18
59 0.17
60 0.17
61 0.17
62 0.21
63 0.22
64 0.21
65 0.19
66 0.22
67 0.23
68 0.29
69 0.3
70 0.27
71 0.29
72 0.28
73 0.28
74 0.34
75 0.36
76 0.32
77 0.35
78 0.36
79 0.33
80 0.37
81 0.39
82 0.32
83 0.29
84 0.28
85 0.24