Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q6D8

Protein Details
Accession S7Q6D8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-29SSAIRRSKAKVAAKKAKKEVVHydrophilic
104-123SSTDKKKVPSTPPTRREKNTHydrophilic
NLS Segment(s)
PositionSequence
13-26RRSKAKVAAKKAKK
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_128852  -  
Amino Acid Sequences MSPQKNTTSSAIRRSKAKVAAKKAKKEVVTHLRPQSPGNTKIGINPLRFVEWGDAPDLFELASLVMDERIPLEYWLIVEPPAPEERGRKREKEEMSGSSSSSVSSTDKKKVPSTPPTRREKNTVPFPVGRRLERIEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.59
4 0.63
5 0.62
6 0.65
7 0.72
8 0.76
9 0.8
10 0.8
11 0.78
12 0.72
13 0.66
14 0.66
15 0.66
16 0.64
17 0.63
18 0.62
19 0.59
20 0.57
21 0.55
22 0.52
23 0.49
24 0.45
25 0.4
26 0.35
27 0.31
28 0.33
29 0.4
30 0.37
31 0.31
32 0.29
33 0.27
34 0.26
35 0.26
36 0.23
37 0.18
38 0.13
39 0.13
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.06
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.08
68 0.09
69 0.09
70 0.1
71 0.16
72 0.24
73 0.32
74 0.37
75 0.39
76 0.43
77 0.51
78 0.53
79 0.54
80 0.51
81 0.46
82 0.47
83 0.44
84 0.38
85 0.32
86 0.28
87 0.21
88 0.16
89 0.14
90 0.11
91 0.16
92 0.2
93 0.25
94 0.29
95 0.33
96 0.38
97 0.44
98 0.5
99 0.55
100 0.62
101 0.66
102 0.71
103 0.77
104 0.81
105 0.78
106 0.78
107 0.76
108 0.75
109 0.75
110 0.72
111 0.68
112 0.67
113 0.66
114 0.67
115 0.64
116 0.56
117 0.51
118 0.49
119 0.49