Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q003

Protein Details
Accession S7Q003    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-105PLTPPHRRGPPPPRRRPRTRARSPGTRPAABasic
NLS Segment(s)
PositionSequence
80-166PHRRGPPPPRRRPRTRARSPGTRPAACPSTRPPRPFRARVTASRFPRPAPTLAATRAQARSSRPRRPSSDRRRSGGTNRARPRLPPR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_139970  -  
Amino Acid Sequences MPHLQARSRPTTSRGSRGRVYPNRPQRLPCPVALALTQATRLNTSLHRETRLNRTHSDIGGSARPPRLRHCPSLLPLTPPHRRGPPPPRRRPRTRARSPGTRPAACPSTRPPRPFRARVTASRFPRPAPTLAATRAQARSSRPRRPSSDRRRSGGTNRARPRLPPRTTSSAARRSSPQVWNSTSRTAISARSGSRCGWARRASASSCCPRSGSGTSAGARCALWSYGEGVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.59
4 0.63
5 0.69
6 0.68
7 0.69
8 0.7
9 0.73
10 0.76
11 0.75
12 0.73
13 0.68
14 0.69
15 0.66
16 0.56
17 0.52
18 0.43
19 0.41
20 0.37
21 0.32
22 0.24
23 0.2
24 0.21
25 0.16
26 0.16
27 0.15
28 0.16
29 0.16
30 0.18
31 0.24
32 0.3
33 0.31
34 0.35
35 0.37
36 0.4
37 0.48
38 0.53
39 0.5
40 0.44
41 0.47
42 0.47
43 0.44
44 0.42
45 0.33
46 0.28
47 0.28
48 0.27
49 0.25
50 0.26
51 0.29
52 0.28
53 0.32
54 0.39
55 0.41
56 0.44
57 0.46
58 0.47
59 0.47
60 0.54
61 0.5
62 0.43
63 0.43
64 0.45
65 0.46
66 0.43
67 0.43
68 0.41
69 0.43
70 0.49
71 0.55
72 0.59
73 0.64
74 0.72
75 0.79
76 0.82
77 0.88
78 0.87
79 0.87
80 0.87
81 0.86
82 0.86
83 0.82
84 0.83
85 0.79
86 0.8
87 0.77
88 0.67
89 0.58
90 0.52
91 0.5
92 0.4
93 0.36
94 0.33
95 0.36
96 0.39
97 0.42
98 0.43
99 0.48
100 0.55
101 0.59
102 0.57
103 0.56
104 0.55
105 0.59
106 0.63
107 0.61
108 0.57
109 0.57
110 0.54
111 0.45
112 0.45
113 0.4
114 0.33
115 0.28
116 0.27
117 0.23
118 0.24
119 0.25
120 0.22
121 0.23
122 0.23
123 0.21
124 0.21
125 0.22
126 0.31
127 0.37
128 0.45
129 0.49
130 0.54
131 0.6
132 0.68
133 0.74
134 0.75
135 0.78
136 0.75
137 0.72
138 0.7
139 0.68
140 0.66
141 0.64
142 0.62
143 0.61
144 0.61
145 0.64
146 0.59
147 0.6
148 0.62
149 0.63
150 0.58
151 0.54
152 0.54
153 0.56
154 0.59
155 0.61
156 0.6
157 0.58
158 0.56
159 0.52
160 0.49
161 0.47
162 0.5
163 0.5
164 0.46
165 0.43
166 0.45
167 0.48
168 0.48
169 0.46
170 0.4
171 0.34
172 0.32
173 0.27
174 0.25
175 0.24
176 0.25
177 0.25
178 0.27
179 0.28
180 0.27
181 0.33
182 0.38
183 0.38
184 0.41
185 0.42
186 0.42
187 0.45
188 0.49
189 0.45
190 0.44
191 0.49
192 0.5
193 0.48
194 0.47
195 0.43
196 0.4
197 0.42
198 0.39
199 0.34
200 0.3
201 0.33
202 0.34
203 0.34
204 0.34
205 0.29
206 0.25
207 0.22
208 0.19
209 0.14
210 0.12
211 0.12
212 0.14