Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PQY3

Protein Details
Accession S7PQY3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-27LTRNTASKKTASRRRGPPGIRDPAKHydrophilic
NLS Segment(s)
PositionSequence
10-28KKTASRRRGPPGIRDPAKH
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_134137  -  
Amino Acid Sequences MALTRNTASKKTASRRRGPPGIRDPAKHAAAATKAAVTALRRKDVPTTRQSAAPGAATPWEKNAIAQALRKPQRIDQVRRPNRTEFVRERAMAHLERIHRRAEELDKVPKTSKLPPCKYQGNERKEEAAKNLRASAPTFLVYANDRRDGICDFCKRSVKLTAAQMEHAEFLKRRKRVGRVILLLRPQVSSQVRKSGPHLKYSTVHWHHVSVAGCKRFVAKEDVPKSPGSIPLSKLKGLDVSGLDRQDIDSVMARIKRCHLNLEPEPVREEEDPERDIAFREKRASRDAYLRNRRELMEVKKAESEQLRKAQRRQEYEVRKAKRIAEVAAAGATASVEGGDLVPTQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.82
4 0.86
5 0.82
6 0.81
7 0.81
8 0.83
9 0.79
10 0.72
11 0.69
12 0.67
13 0.63
14 0.53
15 0.43
16 0.37
17 0.33
18 0.33
19 0.27
20 0.19
21 0.18
22 0.18
23 0.19
24 0.17
25 0.23
26 0.26
27 0.29
28 0.3
29 0.31
30 0.4
31 0.47
32 0.52
33 0.51
34 0.53
35 0.51
36 0.53
37 0.53
38 0.46
39 0.39
40 0.32
41 0.24
42 0.19
43 0.21
44 0.2
45 0.19
46 0.18
47 0.2
48 0.19
49 0.18
50 0.21
51 0.21
52 0.22
53 0.26
54 0.3
55 0.37
56 0.43
57 0.47
58 0.46
59 0.45
60 0.53
61 0.58
62 0.61
63 0.61
64 0.67
65 0.73
66 0.78
67 0.78
68 0.72
69 0.69
70 0.66
71 0.64
72 0.58
73 0.55
74 0.54
75 0.51
76 0.48
77 0.44
78 0.43
79 0.35
80 0.31
81 0.3
82 0.3
83 0.35
84 0.35
85 0.34
86 0.3
87 0.3
88 0.33
89 0.32
90 0.33
91 0.32
92 0.4
93 0.38
94 0.41
95 0.41
96 0.4
97 0.38
98 0.4
99 0.44
100 0.46
101 0.51
102 0.54
103 0.59
104 0.64
105 0.63
106 0.65
107 0.65
108 0.62
109 0.6
110 0.56
111 0.56
112 0.51
113 0.5
114 0.46
115 0.44
116 0.4
117 0.36
118 0.37
119 0.32
120 0.3
121 0.3
122 0.25
123 0.18
124 0.16
125 0.15
126 0.12
127 0.12
128 0.13
129 0.16
130 0.16
131 0.16
132 0.16
133 0.16
134 0.17
135 0.17
136 0.19
137 0.21
138 0.23
139 0.25
140 0.29
141 0.34
142 0.33
143 0.34
144 0.36
145 0.32
146 0.32
147 0.34
148 0.35
149 0.31
150 0.31
151 0.29
152 0.24
153 0.22
154 0.18
155 0.14
156 0.1
157 0.16
158 0.22
159 0.23
160 0.26
161 0.31
162 0.37
163 0.44
164 0.51
165 0.52
166 0.51
167 0.54
168 0.54
169 0.51
170 0.45
171 0.38
172 0.3
173 0.22
174 0.22
175 0.21
176 0.22
177 0.21
178 0.28
179 0.28
180 0.29
181 0.34
182 0.37
183 0.36
184 0.39
185 0.39
186 0.34
187 0.35
188 0.38
189 0.44
190 0.38
191 0.39
192 0.33
193 0.32
194 0.3
195 0.32
196 0.29
197 0.25
198 0.28
199 0.26
200 0.25
201 0.24
202 0.26
203 0.22
204 0.23
205 0.25
206 0.23
207 0.31
208 0.36
209 0.39
210 0.38
211 0.38
212 0.38
213 0.31
214 0.32
215 0.27
216 0.25
217 0.25
218 0.3
219 0.33
220 0.32
221 0.31
222 0.26
223 0.24
224 0.21
225 0.21
226 0.15
227 0.16
228 0.18
229 0.18
230 0.17
231 0.15
232 0.15
233 0.13
234 0.12
235 0.1
236 0.09
237 0.1
238 0.14
239 0.17
240 0.18
241 0.18
242 0.23
243 0.28
244 0.28
245 0.34
246 0.34
247 0.4
248 0.43
249 0.52
250 0.5
251 0.44
252 0.45
253 0.39
254 0.38
255 0.3
256 0.3
257 0.24
258 0.25
259 0.25
260 0.24
261 0.24
262 0.21
263 0.22
264 0.26
265 0.26
266 0.26
267 0.33
268 0.36
269 0.38
270 0.45
271 0.47
272 0.43
273 0.48
274 0.54
275 0.57
276 0.64
277 0.65
278 0.65
279 0.64
280 0.61
281 0.57
282 0.56
283 0.53
284 0.52
285 0.5
286 0.47
287 0.48
288 0.47
289 0.46
290 0.46
291 0.44
292 0.41
293 0.48
294 0.55
295 0.58
296 0.65
297 0.68
298 0.69
299 0.71
300 0.72
301 0.73
302 0.73
303 0.77
304 0.8
305 0.77
306 0.75
307 0.72
308 0.68
309 0.65
310 0.59
311 0.51
312 0.47
313 0.42
314 0.36
315 0.32
316 0.27
317 0.19
318 0.15
319 0.12
320 0.06
321 0.05
322 0.03
323 0.03
324 0.04
325 0.04
326 0.05
327 0.06