Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S5W9

Protein Details
Accession S7S5W9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-57FENEPVFKTKKKQKKTAPRKRKSSAMAVGHydrophilic
NLS Segment(s)
PositionSequence
36-52KTKKKQKKTAPRKRKSS
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
IPR003105  SRA_YDG  
IPR045134  UHRF1/2-like  
Gene Ontology GO:0005634  C:nucleus  
KEGG gtr:GLOTRDRAFT_124542  -  
Pfam View protein in Pfam  
PF02182  SAD_SRA  
PROSITE View protein in PROSITE  
PS51015  YDG  
Amino Acid Sequences MVRTAYELEIEEKKESNRRLMKELLGDRFENEPVFKTKKKQKKTAPRKRKSSAMAVGDGEGSRPAKAPRTSAEATENGEGPRRSQRNAGKTVDYKSEQLLPASRSRLISLKSSDSTMESDPRRTERRSHDPKTFGHIPGIEVGTWWETRKDCSLDAVHAPWVAGISGGPDGAYSVALSGGYEDDVDLGYAFTYTGSGGRDLKGTKNAPKNLRTAPQSSNQTFENPFNQALKRSCETKKPIRVIRGFKLHSEFAPAEGYRYDGLYTVEKAWMEKGMNPKGYLVCKFAFRRLPDQPPIPTKDESVEEEDQGEADDTTETPDEEDTPGPAEDEQEVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.45
4 0.48
5 0.5
6 0.54
7 0.56
8 0.56
9 0.57
10 0.6
11 0.57
12 0.52
13 0.48
14 0.44
15 0.42
16 0.39
17 0.31
18 0.25
19 0.22
20 0.25
21 0.31
22 0.33
23 0.4
24 0.49
25 0.58
26 0.67
27 0.74
28 0.78
29 0.83
30 0.9
31 0.92
32 0.93
33 0.93
34 0.94
35 0.89
36 0.88
37 0.82
38 0.8
39 0.77
40 0.71
41 0.64
42 0.54
43 0.48
44 0.4
45 0.34
46 0.24
47 0.18
48 0.14
49 0.11
50 0.13
51 0.14
52 0.21
53 0.23
54 0.26
55 0.26
56 0.34
57 0.34
58 0.34
59 0.37
60 0.31
61 0.32
62 0.3
63 0.29
64 0.21
65 0.25
66 0.23
67 0.21
68 0.29
69 0.29
70 0.29
71 0.36
72 0.43
73 0.47
74 0.54
75 0.55
76 0.52
77 0.53
78 0.54
79 0.52
80 0.46
81 0.39
82 0.33
83 0.34
84 0.28
85 0.26
86 0.27
87 0.23
88 0.25
89 0.27
90 0.27
91 0.23
92 0.24
93 0.26
94 0.24
95 0.26
96 0.25
97 0.27
98 0.25
99 0.26
100 0.25
101 0.22
102 0.23
103 0.2
104 0.23
105 0.2
106 0.23
107 0.24
108 0.29
109 0.32
110 0.32
111 0.38
112 0.4
113 0.5
114 0.56
115 0.59
116 0.62
117 0.62
118 0.61
119 0.61
120 0.57
121 0.47
122 0.4
123 0.35
124 0.28
125 0.25
126 0.25
127 0.16
128 0.11
129 0.11
130 0.1
131 0.1
132 0.1
133 0.1
134 0.1
135 0.12
136 0.15
137 0.16
138 0.14
139 0.17
140 0.18
141 0.17
142 0.18
143 0.17
144 0.15
145 0.13
146 0.13
147 0.09
148 0.08
149 0.06
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.04
182 0.05
183 0.07
184 0.08
185 0.08
186 0.11
187 0.12
188 0.14
189 0.2
190 0.23
191 0.29
192 0.36
193 0.43
194 0.47
195 0.49
196 0.52
197 0.5
198 0.52
199 0.48
200 0.45
201 0.41
202 0.43
203 0.47
204 0.43
205 0.41
206 0.36
207 0.35
208 0.32
209 0.31
210 0.27
211 0.21
212 0.22
213 0.23
214 0.23
215 0.26
216 0.26
217 0.29
218 0.29
219 0.33
220 0.34
221 0.39
222 0.46
223 0.51
224 0.57
225 0.6
226 0.64
227 0.67
228 0.72
229 0.71
230 0.71
231 0.7
232 0.63
233 0.58
234 0.56
235 0.48
236 0.41
237 0.4
238 0.32
239 0.24
240 0.27
241 0.23
242 0.2
243 0.18
244 0.2
245 0.14
246 0.14
247 0.13
248 0.09
249 0.12
250 0.13
251 0.14
252 0.14
253 0.16
254 0.16
255 0.16
256 0.16
257 0.18
258 0.17
259 0.19
260 0.26
261 0.32
262 0.34
263 0.34
264 0.36
265 0.37
266 0.41
267 0.39
268 0.35
269 0.29
270 0.34
271 0.36
272 0.4
273 0.43
274 0.42
275 0.48
276 0.51
277 0.58
278 0.58
279 0.61
280 0.61
281 0.62
282 0.63
283 0.6
284 0.53
285 0.47
286 0.43
287 0.41
288 0.37
289 0.37
290 0.33
291 0.29
292 0.28
293 0.26
294 0.23
295 0.2
296 0.17
297 0.1
298 0.08
299 0.08
300 0.07
301 0.11
302 0.11
303 0.11
304 0.11
305 0.11
306 0.12
307 0.14
308 0.15
309 0.13
310 0.15
311 0.15
312 0.15
313 0.14
314 0.15