Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GYM2

Protein Details
Accession C1GYM2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-40AGNGNRKRRGRGQGRGCGRREBasic
NLS Segment(s)
PositionSequence
24-34NRKRRGRGQGR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR043472  Macro_dom-like  
IPR019261  PARG_cat_microbial  
KEGG pbl:PAAG_03176  -  
pbl:PAAG_12627  -  
Pfam View protein in Pfam  
PF10021  DUF2263  
Amino Acid Sequences MSNPTKTADNPVNSPHSRDAGNGNRKRRGRGQGRGCGRREHDSERERLRAVSYETKALIPNILAASKKSYLTEGFLYRSPAAPPLLDQRFCPGYTGTKIQVLNVDTFDAGIRELSSNSNPSSTTVTEPTPPAPVAVLNMASDFALGGGWLGGARAQEGSPLQTQHTHCITQAVFLSHAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.38
4 0.35
5 0.33
6 0.37
7 0.39
8 0.48
9 0.51
10 0.55
11 0.61
12 0.64
13 0.69
14 0.68
15 0.69
16 0.68
17 0.71
18 0.73
19 0.74
20 0.81
21 0.83
22 0.76
23 0.73
24 0.67
25 0.64
26 0.59
27 0.56
28 0.55
29 0.52
30 0.57
31 0.56
32 0.55
33 0.49
34 0.44
35 0.39
36 0.33
37 0.33
38 0.33
39 0.29
40 0.28
41 0.28
42 0.28
43 0.28
44 0.25
45 0.2
46 0.12
47 0.12
48 0.1
49 0.11
50 0.1
51 0.1
52 0.13
53 0.14
54 0.14
55 0.13
56 0.14
57 0.13
58 0.15
59 0.17
60 0.16
61 0.16
62 0.17
63 0.19
64 0.18
65 0.18
66 0.16
67 0.15
68 0.13
69 0.11
70 0.12
71 0.17
72 0.2
73 0.2
74 0.19
75 0.21
76 0.22
77 0.22
78 0.22
79 0.15
80 0.14
81 0.16
82 0.19
83 0.16
84 0.19
85 0.19
86 0.18
87 0.2
88 0.19
89 0.17
90 0.15
91 0.15
92 0.1
93 0.1
94 0.1
95 0.07
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.08
102 0.09
103 0.11
104 0.12
105 0.12
106 0.12
107 0.13
108 0.16
109 0.15
110 0.17
111 0.17
112 0.18
113 0.19
114 0.2
115 0.19
116 0.19
117 0.17
118 0.15
119 0.13
120 0.12
121 0.11
122 0.11
123 0.11
124 0.09
125 0.09
126 0.09
127 0.08
128 0.08
129 0.06
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.09
144 0.1
145 0.13
146 0.15
147 0.16
148 0.18
149 0.24
150 0.26
151 0.3
152 0.34
153 0.31
154 0.29
155 0.33
156 0.32
157 0.29
158 0.3
159 0.25