Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RJ10

Protein Details
Accession S7RJ10    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
158-179WNLICPHKTAPPKRKILRRRHTHydrophilic
NLS Segment(s)
PositionSequence
168-178PPKRKILRRRH
Subcellular Location(s) cyto 18, nucl 7
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_131839  -  
Amino Acid Sequences MGTKATFTEQGNGPCEAAFSPKTKSQASEGSKGSPHMKPKPPFTVPVEKPKPDPDRSVVAVILPPACQAAPAPAQTPQLAQACTDNIALTLELPCRESSCYFEQDDVVYVEGMDGHMYLVPVPLSSSKAAEDYHIKGAGMPVRKGGRVVGYGDMVIRWNLICPHKTAPPKRKILRRRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.2
4 0.2
5 0.18
6 0.17
7 0.21
8 0.25
9 0.29
10 0.3
11 0.32
12 0.32
13 0.39
14 0.42
15 0.44
16 0.42
17 0.41
18 0.41
19 0.42
20 0.41
21 0.36
22 0.39
23 0.42
24 0.49
25 0.51
26 0.57
27 0.63
28 0.61
29 0.62
30 0.6
31 0.61
32 0.56
33 0.62
34 0.62
35 0.55
36 0.55
37 0.58
38 0.59
39 0.51
40 0.51
41 0.44
42 0.42
43 0.43
44 0.41
45 0.32
46 0.26
47 0.23
48 0.19
49 0.16
50 0.1
51 0.08
52 0.07
53 0.07
54 0.06
55 0.06
56 0.08
57 0.09
58 0.1
59 0.11
60 0.12
61 0.14
62 0.14
63 0.14
64 0.15
65 0.15
66 0.15
67 0.14
68 0.13
69 0.12
70 0.13
71 0.13
72 0.09
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.1
85 0.13
86 0.16
87 0.18
88 0.18
89 0.18
90 0.18
91 0.17
92 0.17
93 0.13
94 0.11
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.04
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.08
112 0.09
113 0.09
114 0.1
115 0.11
116 0.12
117 0.13
118 0.17
119 0.18
120 0.21
121 0.21
122 0.2
123 0.19
124 0.22
125 0.24
126 0.24
127 0.21
128 0.24
129 0.25
130 0.26
131 0.26
132 0.25
133 0.23
134 0.21
135 0.23
136 0.19
137 0.18
138 0.18
139 0.17
140 0.16
141 0.13
142 0.11
143 0.1
144 0.08
145 0.09
146 0.14
147 0.2
148 0.21
149 0.24
150 0.28
151 0.35
152 0.46
153 0.54
154 0.59
155 0.64
156 0.73
157 0.79
158 0.85
159 0.87