Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S0U4

Protein Details
Accession S7S0U4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
232-256NYDPGPPPPPKEKKERKPRAEGEQABasic
NLS Segment(s)
PositionSequence
238-251PPPPKEKKERKPRA
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002562  3'-5'_exonuclease_dom  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
KEGG gtr:GLOTRDRAFT_26623  -  
Pfam View protein in Pfam  
PF01612  DNA_pol_A_exo1  
CDD cd06141  WRN_exo  
Amino Acid Sequences PAPPPLPPYSWQEKSDNCRLLYIRDHEQADLECSRVTKGPLGFDLEWKPTYVTGEPENKVAVVQLANADRILLLQISAMSKFPDKLRDLLGNPDIVKAGVGIQYDCKKLYQDHGVCLRNCVDLSCLARSADNARWKGKYSQPIGLARLVAVYEELELPKGRVQRSNWERPLNVKQQDYAANDAHSGFIIYTKLIAMAELVQPKPLPLYYTFDVSEGLLVDTSGQPWSPMNPNYDPGPPPPPKEKKERKPRAEGEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.63
4 0.54
5 0.53
6 0.51
7 0.49
8 0.49
9 0.47
10 0.44
11 0.43
12 0.44
13 0.39
14 0.4
15 0.36
16 0.33
17 0.29
18 0.23
19 0.17
20 0.17
21 0.18
22 0.18
23 0.19
24 0.19
25 0.2
26 0.22
27 0.23
28 0.3
29 0.28
30 0.31
31 0.33
32 0.31
33 0.3
34 0.27
35 0.26
36 0.2
37 0.23
38 0.19
39 0.19
40 0.21
41 0.28
42 0.28
43 0.28
44 0.28
45 0.25
46 0.23
47 0.2
48 0.16
49 0.09
50 0.08
51 0.11
52 0.11
53 0.12
54 0.11
55 0.11
56 0.09
57 0.09
58 0.09
59 0.05
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.08
67 0.09
68 0.11
69 0.13
70 0.18
71 0.19
72 0.21
73 0.24
74 0.27
75 0.27
76 0.31
77 0.3
78 0.26
79 0.25
80 0.23
81 0.2
82 0.15
83 0.13
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.11
90 0.13
91 0.15
92 0.15
93 0.14
94 0.14
95 0.15
96 0.18
97 0.24
98 0.23
99 0.27
100 0.34
101 0.38
102 0.37
103 0.38
104 0.35
105 0.26
106 0.24
107 0.2
108 0.13
109 0.11
110 0.13
111 0.12
112 0.12
113 0.11
114 0.11
115 0.12
116 0.14
117 0.17
118 0.21
119 0.23
120 0.24
121 0.25
122 0.28
123 0.32
124 0.33
125 0.36
126 0.33
127 0.35
128 0.38
129 0.39
130 0.39
131 0.35
132 0.3
133 0.22
134 0.19
135 0.14
136 0.09
137 0.06
138 0.05
139 0.04
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.1
146 0.13
147 0.14
148 0.19
149 0.21
150 0.31
151 0.39
152 0.49
153 0.53
154 0.53
155 0.53
156 0.54
157 0.6
158 0.58
159 0.55
160 0.45
161 0.4
162 0.38
163 0.43
164 0.39
165 0.35
166 0.27
167 0.23
168 0.22
169 0.21
170 0.18
171 0.13
172 0.11
173 0.07
174 0.07
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.05
183 0.07
184 0.1
185 0.14
186 0.15
187 0.15
188 0.15
189 0.16
190 0.17
191 0.15
192 0.15
193 0.13
194 0.2
195 0.2
196 0.24
197 0.24
198 0.23
199 0.23
200 0.2
201 0.18
202 0.12
203 0.11
204 0.07
205 0.07
206 0.08
207 0.08
208 0.08
209 0.08
210 0.08
211 0.08
212 0.09
213 0.13
214 0.18
215 0.22
216 0.27
217 0.28
218 0.31
219 0.34
220 0.38
221 0.36
222 0.34
223 0.4
224 0.39
225 0.42
226 0.5
227 0.57
228 0.58
229 0.67
230 0.74
231 0.75
232 0.82
233 0.88
234 0.86
235 0.88
236 0.89