Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RU67

Protein Details
Accession S7RU67    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-98HALKSHWKGKVHKRRCKQLREPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG gtr:GLOTRDRAFT_60136  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHGGNRDVHRAGRTRSRTKDLDQIQLVDLNPKVRAKLEAQPLDFEKPGLAQHYCVECAKYFETDHALKSHWKGKVHKRRCKQLREPAYTIEESERAAGLGREGKRPTSTTVPAPMPMSIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.68
3 0.61
4 0.55
5 0.51
6 0.48
7 0.49
8 0.53
9 0.54
10 0.58
11 0.62
12 0.61
13 0.6
14 0.64
15 0.59
16 0.58
17 0.51
18 0.46
19 0.39
20 0.37
21 0.34
22 0.27
23 0.24
24 0.17
25 0.18
26 0.17
27 0.17
28 0.15
29 0.18
30 0.18
31 0.24
32 0.31
33 0.34
34 0.34
35 0.36
36 0.37
37 0.37
38 0.33
39 0.26
40 0.17
41 0.13
42 0.13
43 0.13
44 0.11
45 0.09
46 0.12
47 0.13
48 0.14
49 0.14
50 0.14
51 0.12
52 0.14
53 0.14
54 0.13
55 0.11
56 0.11
57 0.15
58 0.15
59 0.16
60 0.15
61 0.16
62 0.16
63 0.19
64 0.24
65 0.24
66 0.28
67 0.35
68 0.45
69 0.55
70 0.64
71 0.71
72 0.74
73 0.81
74 0.85
75 0.87
76 0.86
77 0.86
78 0.86
79 0.84
80 0.78
81 0.71
82 0.66
83 0.56
84 0.47
85 0.39
86 0.29
87 0.21
88 0.19
89 0.15
90 0.1
91 0.1
92 0.09
93 0.1
94 0.16
95 0.17
96 0.23
97 0.25
98 0.28
99 0.3
100 0.32
101 0.35
102 0.36
103 0.38
104 0.37
105 0.42
106 0.41
107 0.41
108 0.4
109 0.35