Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RT26

Protein Details
Accession S7RT26    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-73RSCKAQTRSAHRTQRKRKGAWKGKTAHydrophilic
NLS Segment(s)
PositionSequence
58-72HRTQRKRKGAWKGKT
Subcellular Location(s) mito 17, nucl 4.5, cyto_nucl 4, extr 3
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_109918  -  
Amino Acid Sequences MRSPWAVHKCSGAIYITIGAVTQDTNGGRDGYVPAQRYGGGGYVRPIRSCKAQTRSAHRTQRKRKGAWKGKTASGRLDTHGNKRSISSTCPIRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.11
5 0.1
6 0.08
7 0.07
8 0.06
9 0.05
10 0.07
11 0.07
12 0.08
13 0.09
14 0.09
15 0.09
16 0.1
17 0.11
18 0.12
19 0.16
20 0.17
21 0.16
22 0.17
23 0.17
24 0.16
25 0.15
26 0.14
27 0.11
28 0.09
29 0.11
30 0.16
31 0.17
32 0.17
33 0.18
34 0.17
35 0.21
36 0.25
37 0.31
38 0.3
39 0.38
40 0.42
41 0.5
42 0.57
43 0.62
44 0.67
45 0.69
46 0.74
47 0.77
48 0.82
49 0.82
50 0.81
51 0.8
52 0.82
53 0.83
54 0.81
55 0.8
56 0.73
57 0.72
58 0.72
59 0.66
60 0.6
61 0.55
62 0.49
63 0.42
64 0.46
65 0.43
66 0.45
67 0.5
68 0.46
69 0.41
70 0.41
71 0.43
72 0.37
73 0.37
74 0.36
75 0.38