Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RID9

Protein Details
Accession S7RID9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-41SDSDSGYKPKKDKHHRAGHAAFPBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006616  DM9_repeat  
KEGG gtr:GLOTRDRAFT_77982  -  
Pfam View protein in Pfam  
PF11901  DUF3421  
Amino Acid Sequences MSPRPRRRSVDSSSSSSSSDSDSGYKPKKDKHHRAGHAAFPTPVHHPSGHIPSPGFPLPGVSRGNQHAQNPMASESDRPQFPVGGEHRASEHPPPYSAPAPPPSGYRLPLTTTSAFPPLEQAGRPPCFDADGQSPVFLGSALFPNSVHPCKIVPSLNPPCRVPYGGGEHEHNGRYDLLPFTPETMEWVPTSHGRIPDGRRPVEGGYEEHGAKLYHALAQVSGIHVPGKTGEHLGGCNVAFGGAEHTIRENYAILCWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.45
4 0.38
5 0.3
6 0.25
7 0.2
8 0.19
9 0.2
10 0.29
11 0.35
12 0.41
13 0.43
14 0.5
15 0.59
16 0.67
17 0.75
18 0.77
19 0.8
20 0.81
21 0.86
22 0.83
23 0.8
24 0.74
25 0.65
26 0.55
27 0.45
28 0.4
29 0.33
30 0.29
31 0.25
32 0.2
33 0.2
34 0.25
35 0.32
36 0.32
37 0.31
38 0.29
39 0.28
40 0.33
41 0.32
42 0.27
43 0.19
44 0.19
45 0.19
46 0.23
47 0.23
48 0.19
49 0.21
50 0.24
51 0.29
52 0.29
53 0.3
54 0.3
55 0.3
56 0.3
57 0.28
58 0.26
59 0.22
60 0.19
61 0.19
62 0.17
63 0.2
64 0.19
65 0.19
66 0.19
67 0.18
68 0.18
69 0.23
70 0.22
71 0.24
72 0.24
73 0.23
74 0.25
75 0.25
76 0.27
77 0.23
78 0.24
79 0.19
80 0.19
81 0.2
82 0.22
83 0.22
84 0.21
85 0.21
86 0.22
87 0.24
88 0.23
89 0.24
90 0.24
91 0.24
92 0.24
93 0.22
94 0.2
95 0.19
96 0.2
97 0.23
98 0.2
99 0.19
100 0.19
101 0.2
102 0.19
103 0.16
104 0.16
105 0.13
106 0.13
107 0.12
108 0.13
109 0.17
110 0.18
111 0.19
112 0.17
113 0.16
114 0.17
115 0.17
116 0.17
117 0.13
118 0.15
119 0.15
120 0.14
121 0.14
122 0.12
123 0.12
124 0.09
125 0.07
126 0.04
127 0.06
128 0.07
129 0.07
130 0.07
131 0.09
132 0.13
133 0.14
134 0.14
135 0.13
136 0.12
137 0.15
138 0.18
139 0.18
140 0.16
141 0.25
142 0.35
143 0.39
144 0.42
145 0.4
146 0.39
147 0.39
148 0.38
149 0.3
150 0.24
151 0.26
152 0.26
153 0.28
154 0.27
155 0.27
156 0.29
157 0.28
158 0.24
159 0.19
160 0.16
161 0.15
162 0.15
163 0.14
164 0.12
165 0.12
166 0.12
167 0.13
168 0.12
169 0.11
170 0.14
171 0.14
172 0.15
173 0.14
174 0.15
175 0.15
176 0.16
177 0.2
178 0.19
179 0.19
180 0.2
181 0.26
182 0.31
183 0.37
184 0.43
185 0.4
186 0.38
187 0.39
188 0.38
189 0.36
190 0.32
191 0.27
192 0.22
193 0.24
194 0.23
195 0.21
196 0.21
197 0.17
198 0.15
199 0.15
200 0.12
201 0.11
202 0.12
203 0.13
204 0.11
205 0.13
206 0.13
207 0.13
208 0.12
209 0.1
210 0.1
211 0.1
212 0.1
213 0.11
214 0.12
215 0.12
216 0.13
217 0.15
218 0.15
219 0.16
220 0.16
221 0.18
222 0.15
223 0.14
224 0.12
225 0.11
226 0.09
227 0.09
228 0.11
229 0.11
230 0.11
231 0.12
232 0.14
233 0.15
234 0.15
235 0.16
236 0.14
237 0.12