Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QH81

Protein Details
Accession S7QH81    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
179-198ADGVRERTKSAKLRKQKTKSHydrophilic
NLS Segment(s)
PositionSequence
186-198TKSAKLRKQKTKS
Subcellular Location(s) extr 13, plas 10, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013248  Psh3/Shr3  
Gene Ontology GO:0016020  C:membrane  
KEGG gtr:GLOTRDRAFT_127110  -  
Pfam View protein in Pfam  
PF08229  SHR3_chaperone  
Amino Acid Sequences MAWRVSFVVCVTSFLLGTLFTHWIADSLTLWKSPEISDEHLWTAAAYYSILARMPEYLLYFLTATACLGGITILWSLGDGQAGNLMFDGGSIFLYGSAAAVYLYSVLPTLSTFKSLPLHTASTVYPPNLRTLTLDLASNNLICSVALTGILLLQAGRWWAENRDGNDDDAPVMDKPENADGVRERTKSAKLRKQKTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.09
4 0.1
5 0.1
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.11
13 0.09
14 0.11
15 0.12
16 0.13
17 0.14
18 0.13
19 0.14
20 0.13
21 0.16
22 0.17
23 0.21
24 0.23
25 0.24
26 0.25
27 0.24
28 0.24
29 0.2
30 0.16
31 0.12
32 0.09
33 0.07
34 0.05
35 0.06
36 0.06
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.09
44 0.09
45 0.09
46 0.1
47 0.09
48 0.09
49 0.09
50 0.07
51 0.06
52 0.06
53 0.06
54 0.04
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.04
65 0.05
66 0.04
67 0.04
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.05
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.07
97 0.06
98 0.09
99 0.09
100 0.11
101 0.14
102 0.14
103 0.16
104 0.16
105 0.17
106 0.16
107 0.17
108 0.16
109 0.16
110 0.18
111 0.17
112 0.16
113 0.15
114 0.19
115 0.17
116 0.17
117 0.15
118 0.17
119 0.19
120 0.17
121 0.17
122 0.14
123 0.15
124 0.15
125 0.13
126 0.1
127 0.08
128 0.07
129 0.06
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.05
138 0.04
139 0.03
140 0.03
141 0.04
142 0.04
143 0.05
144 0.07
145 0.08
146 0.11
147 0.18
148 0.24
149 0.26
150 0.33
151 0.34
152 0.34
153 0.33
154 0.32
155 0.25
156 0.2
157 0.19
158 0.12
159 0.13
160 0.12
161 0.11
162 0.13
163 0.16
164 0.19
165 0.17
166 0.21
167 0.22
168 0.29
169 0.35
170 0.34
171 0.33
172 0.34
173 0.43
174 0.48
175 0.55
176 0.58
177 0.62
178 0.72