Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q2X8

Protein Details
Accession S7Q2X8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-95ERDPSNCRSRKRVQRPPFHLVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_116647  -  
Amino Acid Sequences MLTKNSMSRVHGPSYMLIATRLTRIQHAKNQAARSRFGQRRSEIWSSMWRSARSDRRWLVKVQCQFRELTHEAERDPSNCRSRKRVQRPPFHLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.21
4 0.18
5 0.16
6 0.14
7 0.15
8 0.17
9 0.15
10 0.19
11 0.24
12 0.28
13 0.33
14 0.4
15 0.45
16 0.48
17 0.54
18 0.54
19 0.51
20 0.48
21 0.45
22 0.48
23 0.46
24 0.46
25 0.46
26 0.43
27 0.44
28 0.48
29 0.47
30 0.38
31 0.35
32 0.36
33 0.33
34 0.36
35 0.36
36 0.29
37 0.29
38 0.35
39 0.42
40 0.39
41 0.44
42 0.43
43 0.46
44 0.48
45 0.5
46 0.49
47 0.48
48 0.51
49 0.5
50 0.49
51 0.45
52 0.43
53 0.39
54 0.41
55 0.36
56 0.34
57 0.32
58 0.3
59 0.29
60 0.33
61 0.34
62 0.27
63 0.3
64 0.32
65 0.36
66 0.41
67 0.45
68 0.49
69 0.58
70 0.68
71 0.74
72 0.78
73 0.79
74 0.84
75 0.88