Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PR59

Protein Details
Accession S7PR59    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-112LYDWIRLSRKKPIPKPKPNKIKNHydrophilic
NLS Segment(s)
PositionSequence
97-112SRKKPIPKPKPNKIKN
Subcellular Location(s) nucl 18, mito 4, cyto 3
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_51472  -  
Amino Acid Sequences MEIGAPMASAYLLGNPDHYTSHKFQTVFWKSYVSEVLQSWEDDNPSEDTENISATLKNKVMVCKSKDGYTPYSTVMDYTHHALKYEDMNLYDWIRLSRKKPIPKPKPNKIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.13
5 0.15
6 0.19
7 0.21
8 0.27
9 0.3
10 0.29
11 0.31
12 0.4
13 0.45
14 0.41
15 0.39
16 0.37
17 0.32
18 0.34
19 0.33
20 0.23
21 0.19
22 0.16
23 0.18
24 0.16
25 0.16
26 0.15
27 0.13
28 0.13
29 0.11
30 0.12
31 0.11
32 0.11
33 0.11
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.09
42 0.12
43 0.11
44 0.12
45 0.13
46 0.15
47 0.2
48 0.25
49 0.27
50 0.31
51 0.32
52 0.33
53 0.35
54 0.36
55 0.36
56 0.32
57 0.3
58 0.25
59 0.25
60 0.23
61 0.2
62 0.17
63 0.14
64 0.13
65 0.15
66 0.17
67 0.16
68 0.17
69 0.17
70 0.18
71 0.2
72 0.21
73 0.19
74 0.16
75 0.18
76 0.2
77 0.21
78 0.19
79 0.17
80 0.18
81 0.21
82 0.25
83 0.26
84 0.35
85 0.43
86 0.53
87 0.62
88 0.71
89 0.77
90 0.83
91 0.91
92 0.91