Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7QJ23

Protein Details
Accession S7QJ23    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTNHNQNKKAHRNGIKKPKTNRTRSLKHydrophilic
NLS Segment(s)
PositionSequence
14-42KKAHRNGIKKPKTNRTRSLKGVDPKFRRN
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_109653  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTNRTRSLKGVDPKFRRNARYALTGSYKARAEAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.84
8 0.84
9 0.82
10 0.82
11 0.82
12 0.82
13 0.81
14 0.8
15 0.78
16 0.75
17 0.72
18 0.68
19 0.65
20 0.63
21 0.63
22 0.63
23 0.6
24 0.6
25 0.64
26 0.65
27 0.62
28 0.58
29 0.55
30 0.5
31 0.51
32 0.46
33 0.43
34 0.43
35 0.44
36 0.41
37 0.4
38 0.37
39 0.31
40 0.34