Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QEF6

Protein Details
Accession S7QEF6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-108PGGKAEKVRLRKENRQRIREQNFLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG gtr:GLOTRDRAFT_126292  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLRAFRPSCLRPLCKTRSYATKAATKPAAAEPEPKSSCPPNTVLVGVNYLKDQPPVLALPDEEYPDWLWKLLEKKELPYDGPGGKAEKVRLRKENRQRIREQNFLKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.6
4 0.61
5 0.58
6 0.59
7 0.6
8 0.59
9 0.54
10 0.56
11 0.51
12 0.54
13 0.5
14 0.4
15 0.36
16 0.33
17 0.34
18 0.26
19 0.31
20 0.28
21 0.35
22 0.36
23 0.34
24 0.34
25 0.33
26 0.34
27 0.3
28 0.29
29 0.23
30 0.22
31 0.23
32 0.2
33 0.17
34 0.18
35 0.16
36 0.14
37 0.12
38 0.11
39 0.1
40 0.1
41 0.09
42 0.06
43 0.07
44 0.07
45 0.08
46 0.07
47 0.07
48 0.09
49 0.09
50 0.11
51 0.09
52 0.1
53 0.1
54 0.11
55 0.11
56 0.1
57 0.09
58 0.11
59 0.16
60 0.18
61 0.25
62 0.25
63 0.28
64 0.34
65 0.36
66 0.34
67 0.31
68 0.33
69 0.26
70 0.27
71 0.25
72 0.22
73 0.22
74 0.24
75 0.26
76 0.3
77 0.37
78 0.43
79 0.51
80 0.57
81 0.66
82 0.74
83 0.8
84 0.83
85 0.83
86 0.84
87 0.85
88 0.85
89 0.84
90 0.79