Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GXK8

Protein Details
Accession C1GXK8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-116KLAGAPWRGKNKNKNKNDKNPLRCIRDAHydrophilic
NLS Segment(s)
PositionSequence
95-103WRGKNKNKN
Subcellular Location(s) cyto 13.5, cyto_nucl 9, mito 8, pero 4
Family & Domain DBs
KEGG pbl:PAAG_03582  -  
Amino Acid Sequences MTYEFTRPLTPVQEKLQHGEDGLVKKRINLLFPACCRKSCIANGFGLSSPGLVLPDAIPSGRQPVHTDVEDDSTETLGSVSIGGAKLAKLAGAPWRGKNKNKNKNDKNPLRCIRDACAKYAIWIDRPTYRAQEKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.46
4 0.39
5 0.35
6 0.33
7 0.31
8 0.29
9 0.32
10 0.34
11 0.3
12 0.3
13 0.37
14 0.36
15 0.33
16 0.32
17 0.33
18 0.35
19 0.4
20 0.48
21 0.43
22 0.42
23 0.44
24 0.41
25 0.4
26 0.39
27 0.39
28 0.32
29 0.33
30 0.33
31 0.31
32 0.28
33 0.24
34 0.18
35 0.12
36 0.09
37 0.07
38 0.07
39 0.05
40 0.05
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.09
48 0.1
49 0.1
50 0.12
51 0.15
52 0.18
53 0.18
54 0.19
55 0.16
56 0.18
57 0.17
58 0.15
59 0.11
60 0.09
61 0.08
62 0.07
63 0.06
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.05
78 0.11
79 0.16
80 0.19
81 0.24
82 0.34
83 0.4
84 0.48
85 0.57
86 0.63
87 0.68
88 0.76
89 0.82
90 0.83
91 0.88
92 0.92
93 0.92
94 0.89
95 0.89
96 0.88
97 0.84
98 0.77
99 0.7
100 0.64
101 0.64
102 0.57
103 0.5
104 0.46
105 0.38
106 0.36
107 0.39
108 0.36
109 0.3
110 0.32
111 0.32
112 0.32
113 0.34
114 0.36
115 0.38
116 0.39