Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QF92

Protein Details
Accession S7QF92    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
326-346AEEEKKREKWHRLGLKSTQQVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG gtr:GLOTRDRAFT_126536  -  
Amino Acid Sequences MTSSEEPLSLRFAQFFGVMTGLMAYGIHFTLFVMTACLLMKQRHTMRRASFYLTYTCLQFTLSSIGMWRDVVGESVSYLEHGNDPAIAGPIEYYNVYFRSPPEWVSVLAFAACTWLQDGLLLYRCLLFYSNKRVIIVLPALLFIGSIVTSILFIIEVATSRDLYGSTSIDLGIPYWALSIAFNLVVTLLIIARLYVLRREVRRSLTPDAADVYTSVGAMLVESAALYSVTGLVFIACYARDSGAQYVFITWLGQFESISPLLIILRVAQGRAWSASAPPPVTNPANVIRLNHMRNSHKAGEQAASGVSVTVETVTADPGTRFAVDAEEEKKREKWHRLGLKSTQQVGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.14
4 0.12
5 0.11
6 0.09
7 0.09
8 0.08
9 0.07
10 0.06
11 0.05
12 0.06
13 0.06
14 0.06
15 0.05
16 0.06
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.12
25 0.14
26 0.15
27 0.19
28 0.26
29 0.34
30 0.41
31 0.45
32 0.51
33 0.54
34 0.6
35 0.59
36 0.57
37 0.52
38 0.47
39 0.47
40 0.42
41 0.37
42 0.3
43 0.28
44 0.21
45 0.19
46 0.16
47 0.14
48 0.14
49 0.13
50 0.12
51 0.13
52 0.14
53 0.14
54 0.13
55 0.12
56 0.09
57 0.09
58 0.1
59 0.09
60 0.08
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.07
71 0.08
72 0.07
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.1
84 0.11
85 0.11
86 0.14
87 0.15
88 0.16
89 0.18
90 0.18
91 0.18
92 0.18
93 0.18
94 0.14
95 0.13
96 0.12
97 0.08
98 0.09
99 0.08
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.1
108 0.1
109 0.1
110 0.1
111 0.1
112 0.1
113 0.12
114 0.12
115 0.14
116 0.23
117 0.28
118 0.28
119 0.29
120 0.28
121 0.27
122 0.28
123 0.24
124 0.16
125 0.11
126 0.1
127 0.1
128 0.09
129 0.09
130 0.05
131 0.05
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.05
147 0.05
148 0.06
149 0.05
150 0.06
151 0.07
152 0.07
153 0.06
154 0.06
155 0.07
156 0.07
157 0.06
158 0.06
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.04
181 0.04
182 0.05
183 0.09
184 0.13
185 0.16
186 0.2
187 0.24
188 0.28
189 0.32
190 0.37
191 0.38
192 0.37
193 0.35
194 0.32
195 0.3
196 0.25
197 0.21
198 0.15
199 0.12
200 0.08
201 0.08
202 0.07
203 0.05
204 0.04
205 0.04
206 0.04
207 0.03
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.03
224 0.05
225 0.05
226 0.06
227 0.07
228 0.09
229 0.12
230 0.12
231 0.13
232 0.12
233 0.12
234 0.12
235 0.11
236 0.1
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.07
243 0.1
244 0.1
245 0.1
246 0.09
247 0.09
248 0.08
249 0.09
250 0.08
251 0.05
252 0.09
253 0.09
254 0.1
255 0.1
256 0.11
257 0.12
258 0.13
259 0.13
260 0.1
261 0.11
262 0.16
263 0.2
264 0.2
265 0.19
266 0.2
267 0.25
268 0.26
269 0.25
270 0.24
271 0.24
272 0.28
273 0.28
274 0.28
275 0.29
276 0.36
277 0.38
278 0.39
279 0.42
280 0.42
281 0.46
282 0.52
283 0.49
284 0.45
285 0.44
286 0.42
287 0.37
288 0.32
289 0.28
290 0.2
291 0.16
292 0.14
293 0.11
294 0.08
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.06
301 0.07
302 0.07
303 0.08
304 0.09
305 0.1
306 0.11
307 0.11
308 0.11
309 0.1
310 0.12
311 0.13
312 0.17
313 0.21
314 0.27
315 0.29
316 0.32
317 0.35
318 0.42
319 0.49
320 0.55
321 0.6
322 0.63
323 0.72
324 0.75
325 0.8
326 0.81
327 0.81
328 0.79
329 0.74