Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PWL5

Protein Details
Accession S7PWL5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPRKSRPRFTVHKKKTPKKDPNGAPSEREBasic
NLS Segment(s)
PositionSequence
3-19RKSRPRFTVHKKKTPKK
226-237GKRKRGGGKGKE
Subcellular Location(s) mito 9.5, cyto_mito 6.5, nucl 6, plas 5, cyto 2.5, extr 2
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_96040  -  
Amino Acid Sequences MPRKSRPRFTVHKKKTPKKDPNGAPSEREWENMQPHSAFKGWTVIIPTVALVAPLTVLPAGTDPDVGRPFIHQFWVVKIRDIRSRQDSSGEDDVWIRVQWYYSPKDVADNTMVKRYIENDIEQEDINANWKDNHPEFYCRYDLECLSRTLSPKHRGTCLCGEPYNPDQDVMHFCPRPSCRKAYHRDCLAENNCVETSPRGREDRLLASSPDSDEPFPLASYQASPGKRKRGGGKGKEAVRSSPLDALPEELLRVARLPITKGVRAGGLVGNVRSVVTARRLVYAALENHGILPEDWEDQIVSKALKDTVLPETTDIPPLRCPGCQGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.94
4 0.93
5 0.92
6 0.93
7 0.92
8 0.91
9 0.9
10 0.82
11 0.75
12 0.67
13 0.63
14 0.53
15 0.45
16 0.38
17 0.35
18 0.37
19 0.36
20 0.36
21 0.31
22 0.31
23 0.33
24 0.31
25 0.25
26 0.2
27 0.22
28 0.19
29 0.2
30 0.22
31 0.19
32 0.18
33 0.18
34 0.17
35 0.13
36 0.12
37 0.1
38 0.07
39 0.06
40 0.05
41 0.05
42 0.06
43 0.04
44 0.04
45 0.04
46 0.05
47 0.07
48 0.07
49 0.08
50 0.08
51 0.14
52 0.15
53 0.16
54 0.15
55 0.16
56 0.2
57 0.19
58 0.21
59 0.19
60 0.18
61 0.24
62 0.32
63 0.3
64 0.32
65 0.35
66 0.36
67 0.42
68 0.44
69 0.45
70 0.44
71 0.48
72 0.44
73 0.45
74 0.43
75 0.41
76 0.42
77 0.35
78 0.28
79 0.25
80 0.24
81 0.2
82 0.18
83 0.12
84 0.08
85 0.08
86 0.11
87 0.15
88 0.18
89 0.19
90 0.21
91 0.21
92 0.24
93 0.24
94 0.24
95 0.24
96 0.25
97 0.24
98 0.28
99 0.28
100 0.24
101 0.24
102 0.23
103 0.23
104 0.21
105 0.2
106 0.17
107 0.18
108 0.19
109 0.18
110 0.17
111 0.12
112 0.1
113 0.13
114 0.12
115 0.11
116 0.11
117 0.12
118 0.18
119 0.18
120 0.23
121 0.21
122 0.26
123 0.27
124 0.3
125 0.31
126 0.25
127 0.26
128 0.23
129 0.22
130 0.21
131 0.2
132 0.17
133 0.18
134 0.19
135 0.19
136 0.22
137 0.29
138 0.32
139 0.36
140 0.37
141 0.41
142 0.4
143 0.43
144 0.44
145 0.4
146 0.35
147 0.31
148 0.29
149 0.28
150 0.28
151 0.27
152 0.2
153 0.17
154 0.14
155 0.15
156 0.19
157 0.19
158 0.23
159 0.2
160 0.2
161 0.26
162 0.29
163 0.35
164 0.34
165 0.35
166 0.38
167 0.46
168 0.56
169 0.59
170 0.64
171 0.62
172 0.61
173 0.57
174 0.59
175 0.52
176 0.46
177 0.37
178 0.32
179 0.26
180 0.23
181 0.23
182 0.16
183 0.17
184 0.17
185 0.21
186 0.2
187 0.21
188 0.23
189 0.26
190 0.28
191 0.28
192 0.26
193 0.23
194 0.23
195 0.23
196 0.22
197 0.2
198 0.17
199 0.14
200 0.12
201 0.13
202 0.12
203 0.11
204 0.1
205 0.09
206 0.08
207 0.08
208 0.12
209 0.17
210 0.19
211 0.25
212 0.3
213 0.39
214 0.42
215 0.46
216 0.51
217 0.55
218 0.63
219 0.65
220 0.7
221 0.68
222 0.7
223 0.71
224 0.64
225 0.55
226 0.48
227 0.43
228 0.34
229 0.32
230 0.27
231 0.22
232 0.21
233 0.21
234 0.19
235 0.17
236 0.15
237 0.11
238 0.11
239 0.09
240 0.1
241 0.08
242 0.1
243 0.11
244 0.13
245 0.19
246 0.24
247 0.25
248 0.25
249 0.26
250 0.23
251 0.22
252 0.22
253 0.17
254 0.15
255 0.16
256 0.15
257 0.14
258 0.13
259 0.13
260 0.11
261 0.11
262 0.1
263 0.13
264 0.18
265 0.18
266 0.21
267 0.21
268 0.21
269 0.23
270 0.26
271 0.23
272 0.21
273 0.21
274 0.19
275 0.19
276 0.19
277 0.17
278 0.11
279 0.12
280 0.12
281 0.12
282 0.12
283 0.12
284 0.12
285 0.12
286 0.14
287 0.13
288 0.12
289 0.11
290 0.14
291 0.14
292 0.15
293 0.15
294 0.17
295 0.21
296 0.23
297 0.23
298 0.22
299 0.25
300 0.26
301 0.32
302 0.3
303 0.26
304 0.27
305 0.31
306 0.32
307 0.28
308 0.31