Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S0F5

Protein Details
Accession S7S0F5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-171FEKIRILEGKKKTPKRLRTEQELPQGYHydrophilic
NLS Segment(s)
PositionSequence
38-63PAKKKARSGVAAETSKGKAKEDAPKK
154-159KKKTPK
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_mito 5.833, pero 3
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_118914  -  
Amino Acid Sequences MAPKRKSDTQDLPEVAVFADSSLPNQDAAVAEAGPSAPAKKKARSGVAAETSKGKAKEDAPKKPTRWQDVVLEGEDDEDGVPIYDDCNDIRRKIRALQKTPGFKITAWLREIGNINSNSYGRFMKATGPTGGAENGTYVAAYKYFEKIRILEGKKKTPKRLRTEQELPQGYDLVDRKRMWVFMPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.34
3 0.24
4 0.18
5 0.09
6 0.11
7 0.09
8 0.1
9 0.12
10 0.12
11 0.12
12 0.12
13 0.12
14 0.1
15 0.11
16 0.11
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.08
24 0.11
25 0.2
26 0.25
27 0.3
28 0.37
29 0.43
30 0.49
31 0.51
32 0.52
33 0.51
34 0.54
35 0.51
36 0.45
37 0.41
38 0.36
39 0.36
40 0.32
41 0.25
42 0.21
43 0.24
44 0.33
45 0.39
46 0.47
47 0.5
48 0.57
49 0.59
50 0.64
51 0.66
52 0.64
53 0.59
54 0.52
55 0.49
56 0.46
57 0.45
58 0.38
59 0.3
60 0.23
61 0.19
62 0.16
63 0.11
64 0.07
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.05
74 0.1
75 0.11
76 0.13
77 0.16
78 0.18
79 0.19
80 0.25
81 0.33
82 0.37
83 0.42
84 0.48
85 0.51
86 0.55
87 0.55
88 0.51
89 0.44
90 0.35
91 0.36
92 0.32
93 0.3
94 0.25
95 0.25
96 0.22
97 0.24
98 0.26
99 0.21
100 0.23
101 0.19
102 0.19
103 0.19
104 0.19
105 0.16
106 0.16
107 0.16
108 0.11
109 0.11
110 0.11
111 0.15
112 0.18
113 0.2
114 0.19
115 0.2
116 0.2
117 0.2
118 0.2
119 0.15
120 0.11
121 0.09
122 0.08
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.12
131 0.14
132 0.17
133 0.19
134 0.19
135 0.25
136 0.34
137 0.38
138 0.42
139 0.48
140 0.56
141 0.64
142 0.71
143 0.76
144 0.76
145 0.81
146 0.82
147 0.86
148 0.83
149 0.83
150 0.83
151 0.8
152 0.81
153 0.76
154 0.68
155 0.58
156 0.51
157 0.41
158 0.39
159 0.35
160 0.3
161 0.32
162 0.3
163 0.32
164 0.34
165 0.35