Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RDE7

Protein Details
Accession S7RDE7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LCLLMLRRRRRLRNNTAYVPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, plas 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG gtr:GLOTRDRAFT_141530  -  
Amino Acid Sequences MTVKSTHLFSAALVLSTLPFASCRTTCYYNGYRYVCRRRGLLGGAIAGIVVGIIAFVLICLLLCLLMLRRRRRLRNNTAYVPPAGPAPPMSTYPSGPGYGAGYQPPHGTNGPMMGRDNAAVPPQNPPPPQYTKHDPPAGIPPQNGADGHQNQYQPPAGPPPAAPAPTHGRNGRQKDNFDFIGGFRADGRENV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.06
6 0.06
7 0.07
8 0.12
9 0.12
10 0.15
11 0.21
12 0.25
13 0.27
14 0.34
15 0.39
16 0.4
17 0.47
18 0.48
19 0.49
20 0.55
21 0.63
22 0.62
23 0.58
24 0.54
25 0.49
26 0.49
27 0.45
28 0.4
29 0.31
30 0.25
31 0.23
32 0.21
33 0.17
34 0.12
35 0.09
36 0.04
37 0.02
38 0.02
39 0.01
40 0.01
41 0.01
42 0.01
43 0.01
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.05
53 0.11
54 0.18
55 0.23
56 0.33
57 0.42
58 0.51
59 0.61
60 0.69
61 0.75
62 0.78
63 0.81
64 0.76
65 0.72
66 0.65
67 0.55
68 0.45
69 0.34
70 0.24
71 0.17
72 0.12
73 0.09
74 0.09
75 0.09
76 0.1
77 0.13
78 0.13
79 0.13
80 0.15
81 0.15
82 0.14
83 0.13
84 0.12
85 0.1
86 0.1
87 0.1
88 0.09
89 0.08
90 0.09
91 0.1
92 0.1
93 0.11
94 0.1
95 0.1
96 0.09
97 0.13
98 0.13
99 0.13
100 0.14
101 0.12
102 0.12
103 0.12
104 0.13
105 0.09
106 0.1
107 0.1
108 0.1
109 0.13
110 0.17
111 0.22
112 0.22
113 0.24
114 0.28
115 0.32
116 0.36
117 0.39
118 0.43
119 0.45
120 0.52
121 0.54
122 0.48
123 0.45
124 0.51
125 0.5
126 0.44
127 0.37
128 0.31
129 0.29
130 0.3
131 0.28
132 0.2
133 0.23
134 0.23
135 0.27
136 0.29
137 0.28
138 0.27
139 0.3
140 0.3
141 0.23
142 0.22
143 0.24
144 0.22
145 0.22
146 0.22
147 0.25
148 0.27
149 0.27
150 0.25
151 0.24
152 0.31
153 0.34
154 0.4
155 0.37
156 0.42
157 0.5
158 0.58
159 0.63
160 0.62
161 0.64
162 0.63
163 0.67
164 0.59
165 0.52
166 0.45
167 0.35
168 0.35
169 0.29
170 0.23
171 0.18
172 0.19