Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QNM4

Protein Details
Accession S7QNM4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
178-204LYVIWDSRKSSKRTRRRLRIASAATREHydrophilic
NLS Segment(s)
PositionSequence
185-199RKSSKRTRRRLRIAS
Subcellular Location(s) cyto 9.5, cyto_nucl 7.5, nucl 4.5, mito 3, extr 3, pero 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG gtr:GLOTRDRAFT_69405  -  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MHLDDRQTLTVSLEDHLVESLQPLCSFLPNDLSEELIACLDSAKSKRRERAAPTIPYDLLSSISKWSRTEGGRAALQAHDPPLDVHAYDMIALLAGTRTAPDRKFPTFVPESEDREEERKRAINDRKAITTLLNAALSVAGAGFAAWYAAGQVRWRDEWRALLGLAVAAIVAIAEGVLYVIWDSRKSSKRTRRRLRIASAATREKKNEDEPLATAEAQNEDLPMDNSVRKRQPFEAARLDTDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.11
5 0.09
6 0.09
7 0.1
8 0.11
9 0.11
10 0.11
11 0.12
12 0.14
13 0.15
14 0.15
15 0.19
16 0.18
17 0.21
18 0.2
19 0.2
20 0.18
21 0.17
22 0.17
23 0.1
24 0.1
25 0.07
26 0.07
27 0.06
28 0.11
29 0.14
30 0.22
31 0.31
32 0.38
33 0.45
34 0.52
35 0.6
36 0.63
37 0.7
38 0.7
39 0.69
40 0.66
41 0.63
42 0.56
43 0.49
44 0.42
45 0.32
46 0.25
47 0.19
48 0.15
49 0.15
50 0.17
51 0.18
52 0.18
53 0.2
54 0.23
55 0.23
56 0.27
57 0.26
58 0.27
59 0.27
60 0.27
61 0.26
62 0.21
63 0.21
64 0.17
65 0.15
66 0.12
67 0.11
68 0.1
69 0.1
70 0.1
71 0.09
72 0.08
73 0.07
74 0.07
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.05
86 0.09
87 0.09
88 0.14
89 0.18
90 0.21
91 0.23
92 0.23
93 0.28
94 0.27
95 0.27
96 0.28
97 0.28
98 0.3
99 0.3
100 0.31
101 0.25
102 0.27
103 0.28
104 0.23
105 0.22
106 0.21
107 0.21
108 0.3
109 0.36
110 0.39
111 0.44
112 0.45
113 0.43
114 0.41
115 0.4
116 0.31
117 0.24
118 0.18
119 0.13
120 0.11
121 0.09
122 0.08
123 0.07
124 0.06
125 0.05
126 0.03
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.04
137 0.04
138 0.06
139 0.08
140 0.1
141 0.13
142 0.14
143 0.16
144 0.17
145 0.19
146 0.2
147 0.2
148 0.18
149 0.15
150 0.14
151 0.11
152 0.1
153 0.07
154 0.04
155 0.02
156 0.02
157 0.02
158 0.02
159 0.01
160 0.01
161 0.01
162 0.01
163 0.02
164 0.02
165 0.02
166 0.02
167 0.04
168 0.05
169 0.06
170 0.09
171 0.17
172 0.25
173 0.3
174 0.41
175 0.51
176 0.61
177 0.72
178 0.8
179 0.83
180 0.87
181 0.9
182 0.88
183 0.87
184 0.84
185 0.82
186 0.79
187 0.77
188 0.72
189 0.67
190 0.62
191 0.55
192 0.52
193 0.48
194 0.48
195 0.42
196 0.4
197 0.37
198 0.38
199 0.37
200 0.33
201 0.28
202 0.22
203 0.19
204 0.18
205 0.16
206 0.12
207 0.1
208 0.11
209 0.12
210 0.12
211 0.13
212 0.17
213 0.21
214 0.29
215 0.37
216 0.4
217 0.45
218 0.47
219 0.55
220 0.56
221 0.6
222 0.62
223 0.58