Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q235

Protein Details
Accession S7Q235    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-34NIPKTRRTYCASKNCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
PositionSequence
40-64KRRYDRKQTGYGGQKKPVFHKKAKT
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_63194  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCASKNCRKHTPHKVTQYKKGKDSLVAQGKRRYDRKQTGYGGQKKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.82
4 0.85
5 0.83
6 0.83
7 0.83
8 0.83
9 0.82
10 0.83
11 0.85
12 0.82
13 0.86
14 0.86
15 0.81
16 0.75
17 0.7
18 0.6
19 0.54
20 0.51
21 0.51
22 0.5
23 0.49
24 0.49
25 0.49
26 0.53
27 0.55
28 0.57
29 0.52
30 0.52
31 0.57
32 0.58
33 0.61
34 0.59
35 0.6
36 0.64
37 0.67
38 0.6
39 0.57
40 0.54
41 0.47
42 0.52
43 0.54
44 0.5
45 0.47
46 0.52
47 0.57
48 0.64
49 0.72
50 0.73
51 0.7
52 0.71
53 0.74
54 0.74
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.31
66 0.3
67 0.35
68 0.41
69 0.44
70 0.47
71 0.57
72 0.64
73 0.7
74 0.67
75 0.61
76 0.58
77 0.53
78 0.53
79 0.53
80 0.53
81 0.54
82 0.57
83 0.54
84 0.5
85 0.48
86 0.42