Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7R6N7

Protein Details
Accession S7R6N7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-106MLSTRNRRREYKSKGEKRVAKBasic
NLS Segment(s)
PositionSequence
91-106NRRREYKSKGEKRVAK
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_11911  -  
Amino Acid Sequences MNTINTSTGYSPFQLRFGRSPRVIPPLQTQISSSSVDLKAAELLANIEACVADARDELLASKVDQAFHANKSRGKETRFKIGDLVMLSTRNRRREYKSKGEKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.34
4 0.37
5 0.44
6 0.42
7 0.44
8 0.43
9 0.48
10 0.45
11 0.41
12 0.42
13 0.41
14 0.41
15 0.37
16 0.34
17 0.29
18 0.3
19 0.28
20 0.22
21 0.18
22 0.17
23 0.17
24 0.16
25 0.13
26 0.11
27 0.1
28 0.1
29 0.05
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.06
48 0.09
49 0.09
50 0.1
51 0.1
52 0.14
53 0.15
54 0.18
55 0.24
56 0.25
57 0.27
58 0.3
59 0.37
60 0.38
61 0.41
62 0.46
63 0.43
64 0.51
65 0.5
66 0.47
67 0.42
68 0.38
69 0.37
70 0.29
71 0.28
72 0.19
73 0.2
74 0.2
75 0.27
76 0.33
77 0.36
78 0.41
79 0.44
80 0.52
81 0.6
82 0.68
83 0.71
84 0.76
85 0.79
86 0.84