Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QBC9

Protein Details
Accession S7QBC9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-35EEDHRKRRRNRTTQSCVNCHTSKRMCDRKRPCGRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG gtr:GLOTRDRAFT_17704  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences EEDHRKRRRNRTTQSCVNCHTSKRMCDRKRPCGRCTQLGLTGLCVYEVDDPNQKHDDQDEKSRLQKRVAELEGVIREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.77
4 0.73
5 0.65
6 0.57
7 0.56
8 0.51
9 0.49
10 0.54
11 0.6
12 0.59
13 0.66
14 0.73
15 0.75
16 0.81
17 0.8
18 0.73
19 0.73
20 0.71
21 0.67
22 0.63
23 0.55
24 0.47
25 0.44
26 0.4
27 0.31
28 0.26
29 0.2
30 0.15
31 0.12
32 0.09
33 0.1
34 0.11
35 0.12
36 0.17
37 0.18
38 0.22
39 0.24
40 0.23
41 0.2
42 0.22
43 0.28
44 0.26
45 0.35
46 0.37
47 0.38
48 0.46
49 0.53
50 0.53
51 0.52
52 0.53
53 0.49
54 0.53
55 0.51
56 0.46
57 0.39
58 0.42