Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RYZ2

Protein Details
Accession S7RYZ2    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-28GNSTHKNKGKGKAQEPKNNASKQHydrophilic
NLS Segment(s)
PositionSequence
178-193KGKGNGKRSAGAQGGG
196-196K
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0001682  P:tRNA 5'-leader removal  
KEGG gtr:GLOTRDRAFT_127139  -  
Amino Acid Sequences MADTLGNSTHKNKGKGKAQEPKNNASKQTSGYTVRKLNPRRPFPTVPSSVSATGPRSAHTEGKNYICISRKTPLAAYLRRCKDIILKDGYKSLHLSAMGAAIPHLLLLSTSLPSILPFSPDEIHTEVRTGTVEVQDELIPEDEDEDISYRTRGKSSLSIVIKIGEGDPEDEPRVSNGKGKGNGKRSAGAQGGGEGKRNKTSTPEGGKEDAIVFQEPEQENMDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.75
4 0.76
5 0.8
6 0.82
7 0.81
8 0.81
9 0.8
10 0.75
11 0.69
12 0.64
13 0.57
14 0.5
15 0.48
16 0.44
17 0.43
18 0.42
19 0.45
20 0.46
21 0.49
22 0.55
23 0.59
24 0.63
25 0.66
26 0.7
27 0.7
28 0.72
29 0.71
30 0.68
31 0.69
32 0.65
33 0.58
34 0.52
35 0.49
36 0.43
37 0.38
38 0.35
39 0.28
40 0.27
41 0.24
42 0.21
43 0.22
44 0.23
45 0.27
46 0.27
47 0.3
48 0.3
49 0.32
50 0.34
51 0.31
52 0.32
53 0.32
54 0.31
55 0.3
56 0.29
57 0.28
58 0.27
59 0.27
60 0.3
61 0.32
62 0.36
63 0.39
64 0.45
65 0.47
66 0.47
67 0.46
68 0.41
69 0.4
70 0.4
71 0.39
72 0.37
73 0.35
74 0.34
75 0.37
76 0.37
77 0.31
78 0.27
79 0.21
80 0.15
81 0.13
82 0.13
83 0.09
84 0.1
85 0.08
86 0.07
87 0.06
88 0.04
89 0.04
90 0.04
91 0.03
92 0.02
93 0.02
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.07
102 0.06
103 0.07
104 0.07
105 0.09
106 0.1
107 0.1
108 0.13
109 0.13
110 0.15
111 0.13
112 0.14
113 0.12
114 0.11
115 0.11
116 0.09
117 0.08
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.08
136 0.1
137 0.1
138 0.11
139 0.12
140 0.14
141 0.18
142 0.21
143 0.29
144 0.29
145 0.29
146 0.29
147 0.29
148 0.26
149 0.21
150 0.18
151 0.1
152 0.09
153 0.1
154 0.1
155 0.12
156 0.13
157 0.13
158 0.13
159 0.14
160 0.17
161 0.16
162 0.2
163 0.23
164 0.29
165 0.36
166 0.42
167 0.49
168 0.53
169 0.58
170 0.55
171 0.53
172 0.47
173 0.47
174 0.42
175 0.35
176 0.27
177 0.25
178 0.28
179 0.26
180 0.3
181 0.27
182 0.28
183 0.33
184 0.34
185 0.32
186 0.32
187 0.39
188 0.42
189 0.48
190 0.51
191 0.49
192 0.51
193 0.5
194 0.45
195 0.39
196 0.31
197 0.25
198 0.21
199 0.17
200 0.15
201 0.23
202 0.22
203 0.23
204 0.24