Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1HCF5

Protein Details
Accession C1HCF5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-104KPSSEHTHRIQKKVRRKTRPSITFAAHydrophilic
NLS Segment(s)
PositionSequence
87-116RIQKKVRRKTRPSITFAAHPLKRKRLSKKK
Subcellular Location(s) nucl 13.5mito_nucl 13.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG pbl:PAAG_08446  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSSVKQHNKAKLRAEVFGPVVDRRTERLSAKLVALASKPKEVNMYDAEKLDMSREAQDDERKEMDIDEPSGMTKPSSEHTHRIQKKVRRKTRPSITFAAHPLKRKRLSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.75
4 0.67
5 0.6
6 0.54
7 0.49
8 0.41
9 0.36
10 0.31
11 0.23
12 0.22
13 0.21
14 0.2
15 0.19
16 0.21
17 0.24
18 0.23
19 0.26
20 0.28
21 0.27
22 0.27
23 0.26
24 0.22
25 0.2
26 0.19
27 0.2
28 0.18
29 0.21
30 0.2
31 0.18
32 0.21
33 0.2
34 0.22
35 0.21
36 0.23
37 0.2
38 0.2
39 0.2
40 0.17
41 0.17
42 0.14
43 0.11
44 0.08
45 0.09
46 0.09
47 0.1
48 0.12
49 0.16
50 0.16
51 0.19
52 0.19
53 0.18
54 0.17
55 0.16
56 0.16
57 0.14
58 0.13
59 0.11
60 0.1
61 0.1
62 0.11
63 0.1
64 0.08
65 0.07
66 0.07
67 0.11
68 0.18
69 0.21
70 0.26
71 0.33
72 0.44
73 0.5
74 0.57
75 0.62
76 0.64
77 0.71
78 0.77
79 0.81
80 0.81
81 0.84
82 0.86
83 0.88
84 0.88
85 0.84
86 0.79
87 0.73
88 0.68
89 0.65
90 0.64
91 0.57
92 0.57
93 0.58
94 0.61
95 0.66
96 0.7