Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RKD3

Protein Details
Accession S7RKD3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGNKQSSAPNPSRRRRTNPPEPAQPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, cyto 3, cyto_mito 2.833
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_130200  -  
Amino Acid Sequences MGNKQSSAPNPSRRRRTNPPEPAQPSASQNTPQAPNAEGNMNSGDAASFVSTTTTLVPSTSITAQSHAVGAGVMGQPSPSSPSASRDYESSFAALSSSFGFGAAAPVVPRKAPKSDGEQSMKSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.86
5 0.86
6 0.84
7 0.84
8 0.81
9 0.77
10 0.7
11 0.62
12 0.55
13 0.48
14 0.42
15 0.34
16 0.31
17 0.31
18 0.3
19 0.29
20 0.26
21 0.24
22 0.23
23 0.22
24 0.22
25 0.17
26 0.16
27 0.15
28 0.14
29 0.12
30 0.11
31 0.09
32 0.06
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.1
54 0.08
55 0.08
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.08
66 0.07
67 0.1
68 0.11
69 0.15
70 0.2
71 0.23
72 0.23
73 0.22
74 0.24
75 0.23
76 0.23
77 0.19
78 0.14
79 0.12
80 0.11
81 0.1
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.08
90 0.08
91 0.07
92 0.07
93 0.1
94 0.11
95 0.12
96 0.16
97 0.18
98 0.23
99 0.26
100 0.3
101 0.37
102 0.44
103 0.52
104 0.55
105 0.57