Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RLN0

Protein Details
Accession S7RLN0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-80AFEKHWRRLEKFRKDTRQLRVLKBasic
NLS Segment(s)
Subcellular Location(s) golg 6, mito 5, E.R. 5, plas 4, cyto_mito 4, cyto 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045341  DUF6532  
Gene Ontology GO:0016020  C:membrane  
KEGG gtr:GLOTRDRAFT_22902  -  
Pfam View protein in Pfam  
PF20149  DUF6532  
Amino Acid Sequences IWFHNKRDTGVRYSECFKRGIPLVTIALVLTAVQAVLEEWTTGLRVQSEFSERAYKEAFEKHWRRLEKFRKDTRQLRVLKHIRMQLLMNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.43
3 0.4
4 0.35
5 0.32
6 0.32
7 0.31
8 0.27
9 0.25
10 0.24
11 0.22
12 0.22
13 0.17
14 0.13
15 0.1
16 0.08
17 0.05
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.1
36 0.1
37 0.12
38 0.18
39 0.17
40 0.19
41 0.19
42 0.19
43 0.18
44 0.22
45 0.24
46 0.29
47 0.33
48 0.38
49 0.45
50 0.5
51 0.53
52 0.59
53 0.66
54 0.67
55 0.73
56 0.76
57 0.78
58 0.83
59 0.86
60 0.84
61 0.83
62 0.79
63 0.74
64 0.75
65 0.72
66 0.69
67 0.68
68 0.65
69 0.58
70 0.53