Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q7U0

Protein Details
Accession S7Q7U0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-90QALLRRRRLRAPRPLPSHFGHydrophilic
NLS Segment(s)
PositionSequence
76-80RRRLR
Subcellular Location(s) mito 14, cyto 8.5, cyto_nucl 8, nucl 4.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_129260  -  
Amino Acid Sequences MTTRRGIPGELDIASLDNSAANVSVASVEEVDSAPAPGAAGERVEPPSVPSVGNADARPVVHGEAMAPRDQALLRRRRLRAPRPLPSHFGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.1
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.04
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.07
31 0.08
32 0.07
33 0.08
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.12
40 0.14
41 0.13
42 0.12
43 0.13
44 0.13
45 0.13
46 0.12
47 0.1
48 0.08
49 0.08
50 0.08
51 0.11
52 0.12
53 0.12
54 0.12
55 0.11
56 0.13
57 0.13
58 0.19
59 0.24
60 0.31
61 0.39
62 0.48
63 0.52
64 0.6
65 0.7
66 0.73
67 0.76
68 0.77
69 0.79
70 0.79
71 0.81