Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7R9C9

Protein Details
Accession S7R9C9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-73DDAPSQSSAHRRRRLKRLVRGLTRMFHydrophilic
NLS Segment(s)
PositionSequence
58-64RRRRLKR
Subcellular Location(s) nucl 9, cyto 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
KEGG gtr:GLOTRDRAFT_141354  -  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MPIHGLPDYAVGSHVVEYGLPWQGPAPVDAPSLLETATDGTMIRTESDDAPSQSSAHRRRRLKRLVRGLTRMFGSRASQHYTESNNDKMDESPPRRLIRPEEWRAYGYWARPYIRGVGIVRNSTPSSTSDDVDPDDAFGDLWGPRGSPHPERWRPIRGHPTLPPRPDGFETPRPGSPVPPPRDLQLNPYLRHRLVGMPTIIFDISMEPTAITFSETQNLIPLMPGDLAQPATFPLVTKLVIAAVADDAASSWPWPIRIYNPRGVKVEDVFDCIYENFQQFLTRDEYYGLTEKKRDLVTQALRERCKPASDNPYAPEYTDEGVRRYDYMVGRTLFRGLEPHPYDDAAWILFVGSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.09
5 0.11
6 0.14
7 0.13
8 0.12
9 0.12
10 0.15
11 0.16
12 0.17
13 0.15
14 0.13
15 0.14
16 0.14
17 0.15
18 0.14
19 0.13
20 0.12
21 0.1
22 0.09
23 0.1
24 0.1
25 0.09
26 0.07
27 0.07
28 0.09
29 0.1
30 0.1
31 0.1
32 0.12
33 0.14
34 0.17
35 0.2
36 0.2
37 0.22
38 0.22
39 0.22
40 0.24
41 0.32
42 0.38
43 0.44
44 0.52
45 0.59
46 0.67
47 0.77
48 0.84
49 0.85
50 0.86
51 0.87
52 0.88
53 0.87
54 0.86
55 0.78
56 0.71
57 0.62
58 0.54
59 0.44
60 0.35
61 0.3
62 0.27
63 0.27
64 0.29
65 0.28
66 0.28
67 0.3
68 0.31
69 0.35
70 0.34
71 0.34
72 0.3
73 0.3
74 0.3
75 0.27
76 0.29
77 0.33
78 0.33
79 0.37
80 0.42
81 0.44
82 0.46
83 0.48
84 0.5
85 0.5
86 0.55
87 0.55
88 0.54
89 0.53
90 0.52
91 0.49
92 0.48
93 0.42
94 0.34
95 0.32
96 0.31
97 0.3
98 0.3
99 0.3
100 0.28
101 0.26
102 0.27
103 0.22
104 0.24
105 0.25
106 0.26
107 0.25
108 0.24
109 0.24
110 0.2
111 0.2
112 0.15
113 0.19
114 0.19
115 0.19
116 0.17
117 0.18
118 0.18
119 0.18
120 0.16
121 0.1
122 0.09
123 0.08
124 0.07
125 0.06
126 0.06
127 0.05
128 0.07
129 0.06
130 0.06
131 0.07
132 0.11
133 0.16
134 0.18
135 0.26
136 0.36
137 0.41
138 0.46
139 0.5
140 0.54
141 0.53
142 0.57
143 0.59
144 0.52
145 0.51
146 0.53
147 0.57
148 0.56
149 0.55
150 0.5
151 0.41
152 0.4
153 0.37
154 0.35
155 0.32
156 0.32
157 0.34
158 0.34
159 0.34
160 0.33
161 0.32
162 0.29
163 0.3
164 0.33
165 0.33
166 0.34
167 0.34
168 0.33
169 0.38
170 0.36
171 0.34
172 0.34
173 0.35
174 0.32
175 0.36
176 0.38
177 0.33
178 0.33
179 0.29
180 0.22
181 0.19
182 0.21
183 0.18
184 0.14
185 0.14
186 0.15
187 0.13
188 0.1
189 0.09
190 0.06
191 0.06
192 0.06
193 0.06
194 0.05
195 0.05
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.09
202 0.1
203 0.1
204 0.11
205 0.11
206 0.1
207 0.09
208 0.09
209 0.07
210 0.06
211 0.07
212 0.06
213 0.07
214 0.07
215 0.07
216 0.07
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.09
224 0.09
225 0.08
226 0.08
227 0.08
228 0.07
229 0.06
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.06
240 0.07
241 0.08
242 0.1
243 0.17
244 0.26
245 0.32
246 0.39
247 0.44
248 0.47
249 0.49
250 0.49
251 0.44
252 0.37
253 0.36
254 0.29
255 0.27
256 0.24
257 0.21
258 0.21
259 0.18
260 0.18
261 0.15
262 0.15
263 0.12
264 0.12
265 0.15
266 0.14
267 0.17
268 0.2
269 0.18
270 0.18
271 0.19
272 0.19
273 0.2
274 0.26
275 0.26
276 0.24
277 0.26
278 0.27
279 0.31
280 0.32
281 0.3
282 0.27
283 0.34
284 0.39
285 0.45
286 0.52
287 0.54
288 0.56
289 0.57
290 0.59
291 0.52
292 0.49
293 0.43
294 0.44
295 0.46
296 0.5
297 0.52
298 0.5
299 0.53
300 0.48
301 0.45
302 0.38
303 0.31
304 0.25
305 0.26
306 0.25
307 0.21
308 0.23
309 0.24
310 0.22
311 0.21
312 0.26
313 0.23
314 0.25
315 0.3
316 0.29
317 0.3
318 0.3
319 0.31
320 0.25
321 0.23
322 0.23
323 0.18
324 0.28
325 0.29
326 0.32
327 0.31
328 0.32
329 0.32
330 0.29
331 0.29
332 0.19
333 0.16
334 0.11