Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RYW7

Protein Details
Accession S7RYW7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-26RAASRLPTRAYRRRPNAVRLLSHydrophilic
NLS Segment(s)
PositionSequence
118-127PKGPQGRRKR
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
KEGG gtr:GLOTRDRAFT_73135  -  
Pfam View protein in Pfam  
PF02410  RsfS  
Amino Acid Sequences MQVFRAASRLPTRAYRRRPNAVRLLSTAPSSSPSSSSNSNRPVPWFVDAEAERSHDLRPNPPHLPSKEVLATVPPIPENVPEVVKNLHAELVKSPHLEPSELLVREPPEIPPGPPLPPKGPQGRRKRGSTYAGEGVLYPTSGIWNWLILAQVKEGTEKRGAIESVVRLVRKTLLKMEPPLPLPPNAKRKVNDTWAMIDAGDFAVHIMSKSAKEKFFTRMEEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.79
5 0.82
6 0.82
7 0.83
8 0.79
9 0.73
10 0.66
11 0.62
12 0.53
13 0.47
14 0.39
15 0.29
16 0.25
17 0.24
18 0.21
19 0.18
20 0.18
21 0.21
22 0.27
23 0.32
24 0.36
25 0.4
26 0.44
27 0.43
28 0.45
29 0.45
30 0.4
31 0.38
32 0.32
33 0.26
34 0.29
35 0.28
36 0.27
37 0.24
38 0.24
39 0.22
40 0.21
41 0.21
42 0.19
43 0.2
44 0.25
45 0.3
46 0.35
47 0.36
48 0.4
49 0.47
50 0.44
51 0.48
52 0.41
53 0.39
54 0.34
55 0.32
56 0.27
57 0.21
58 0.21
59 0.16
60 0.17
61 0.12
62 0.11
63 0.11
64 0.11
65 0.12
66 0.11
67 0.11
68 0.11
69 0.12
70 0.12
71 0.13
72 0.13
73 0.11
74 0.13
75 0.12
76 0.12
77 0.12
78 0.15
79 0.16
80 0.16
81 0.16
82 0.16
83 0.17
84 0.17
85 0.15
86 0.15
87 0.19
88 0.18
89 0.18
90 0.16
91 0.16
92 0.17
93 0.17
94 0.14
95 0.11
96 0.12
97 0.12
98 0.14
99 0.15
100 0.16
101 0.18
102 0.21
103 0.2
104 0.23
105 0.27
106 0.34
107 0.41
108 0.48
109 0.56
110 0.64
111 0.67
112 0.68
113 0.68
114 0.65
115 0.62
116 0.56
117 0.51
118 0.43
119 0.38
120 0.34
121 0.28
122 0.23
123 0.17
124 0.13
125 0.08
126 0.05
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.08
136 0.09
137 0.08
138 0.1
139 0.1
140 0.13
141 0.13
142 0.15
143 0.16
144 0.16
145 0.17
146 0.18
147 0.18
148 0.16
149 0.19
150 0.16
151 0.2
152 0.22
153 0.21
154 0.18
155 0.19
156 0.23
157 0.23
158 0.24
159 0.26
160 0.29
161 0.34
162 0.38
163 0.41
164 0.4
165 0.4
166 0.43
167 0.38
168 0.37
169 0.38
170 0.42
171 0.49
172 0.5
173 0.54
174 0.51
175 0.55
176 0.58
177 0.6
178 0.58
179 0.51
180 0.49
181 0.43
182 0.42
183 0.36
184 0.27
185 0.2
186 0.14
187 0.11
188 0.07
189 0.05
190 0.05
191 0.06
192 0.06
193 0.07
194 0.09
195 0.12
196 0.18
197 0.24
198 0.27
199 0.3
200 0.33
201 0.39
202 0.44