Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QHY8

Protein Details
Accession S7QHY8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
167-198RSPIRARDRFPPRRRSPSYNRGRRRTRSPSYSHydrophilic
219-248SSYSRYSRSKSRSRSYSRGRRSYSRDDIRDHydrophilic
NLS Segment(s)
PositionSequence
98-137PSRPRIRNGRDRPRSLSRSPSRSLTPPPRRFARRGGYEPR
142-196YRPRYGRRGPPPLRDTYRPVSRSRSRSPIRARDRFPPRRRSPSYNRGRRRTRSPS
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG gtr:GLOTRDRAFT_33824  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MENGGGLDKPHARVVVVTNLTRNVVEAHLKTIFGFYGEITKVDLPLFGKSGQNRGKAALEFADPKAAHEASSHMDGGQIDGAIIKAELSDLPIRSPSPSRPRIRNGRDRPRSLSRSPSRSLTPPPRRFARRGGYEPRQDDTYRPRYGRRGPPPLRDTYRPVSRSRSRSPIRARDRFPPRRRSPSYNRGRRRTRSPSYSVRSSRSRTRSPYSRSRSASYSSYSRYSRSKSRSRSYSRGRRSYSRDDIRDSRSRSPRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.31
4 0.3
5 0.3
6 0.31
7 0.32
8 0.29
9 0.26
10 0.18
11 0.17
12 0.21
13 0.19
14 0.22
15 0.22
16 0.22
17 0.22
18 0.21
19 0.18
20 0.13
21 0.12
22 0.09
23 0.13
24 0.13
25 0.13
26 0.14
27 0.15
28 0.15
29 0.14
30 0.16
31 0.12
32 0.13
33 0.15
34 0.14
35 0.18
36 0.19
37 0.29
38 0.33
39 0.36
40 0.35
41 0.36
42 0.38
43 0.34
44 0.33
45 0.26
46 0.23
47 0.21
48 0.21
49 0.25
50 0.21
51 0.22
52 0.24
53 0.22
54 0.2
55 0.18
56 0.19
57 0.15
58 0.17
59 0.16
60 0.12
61 0.13
62 0.13
63 0.13
64 0.11
65 0.08
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.03
73 0.03
74 0.04
75 0.06
76 0.08
77 0.09
78 0.09
79 0.11
80 0.11
81 0.13
82 0.16
83 0.21
84 0.28
85 0.37
86 0.42
87 0.47
88 0.55
89 0.64
90 0.7
91 0.74
92 0.75
93 0.77
94 0.79
95 0.77
96 0.76
97 0.74
98 0.71
99 0.63
100 0.63
101 0.59
102 0.56
103 0.54
104 0.5
105 0.44
106 0.4
107 0.45
108 0.46
109 0.5
110 0.51
111 0.53
112 0.57
113 0.59
114 0.59
115 0.59
116 0.56
117 0.52
118 0.52
119 0.56
120 0.56
121 0.57
122 0.56
123 0.51
124 0.45
125 0.39
126 0.35
127 0.36
128 0.36
129 0.35
130 0.35
131 0.36
132 0.39
133 0.48
134 0.55
135 0.55
136 0.59
137 0.59
138 0.67
139 0.68
140 0.69
141 0.65
142 0.59
143 0.56
144 0.52
145 0.55
146 0.49
147 0.48
148 0.49
149 0.52
150 0.56
151 0.55
152 0.58
153 0.54
154 0.6
155 0.66
156 0.68
157 0.7
158 0.71
159 0.68
160 0.68
161 0.75
162 0.77
163 0.77
164 0.77
165 0.76
166 0.78
167 0.82
168 0.82
169 0.8
170 0.8
171 0.83
172 0.83
173 0.84
174 0.83
175 0.86
176 0.83
177 0.83
178 0.83
179 0.81
180 0.78
181 0.76
182 0.76
183 0.73
184 0.76
185 0.71
186 0.67
187 0.64
188 0.62
189 0.64
190 0.62
191 0.63
192 0.6
193 0.64
194 0.68
195 0.68
196 0.74
197 0.72
198 0.74
199 0.71
200 0.68
201 0.62
202 0.57
203 0.53
204 0.47
205 0.45
206 0.4
207 0.41
208 0.39
209 0.39
210 0.41
211 0.44
212 0.49
213 0.52
214 0.58
215 0.61
216 0.7
217 0.76
218 0.79
219 0.83
220 0.85
221 0.87
222 0.87
223 0.88
224 0.84
225 0.83
226 0.82
227 0.82
228 0.82
229 0.81
230 0.75
231 0.74
232 0.74
233 0.73
234 0.73
235 0.69
236 0.69
237 0.68