Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QFL8

Protein Details
Accession S7QFL8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
112-131APLKKAKGPKSPKAEKKKEEBasic
NLS Segment(s)
PositionSequence
94-129APKKEERPKSPGLFSKLLAPLKKAKGPKSPKAEKKK
206-226KEDKKEDAKKSSKVGRRLSAR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_136971  -  
Amino Acid Sequences MSAEAAPAAPVEEVKPTETPAAEPEVPTAEVPKAEEPVPATEVAVAAPAAEEPKAEQPEAAAPAVPETTTEAATEEPAKEEAKPAEEAAPAAEAPKKEERPKSPGLFSKLLAPLKKAKGPKSPKAEKKKEEVEPTPAPVAEEPAKEEAKAEETPAAPAAEEAAAAQAAEPVKETEVAAAPEAAPENAEAPKEAATEATEAPKETPKEDKKEDAKKSSKVGRRLSARVGDFFKPKHKESHNTPPKVDENPPQIEEPAAVAPLENPATETAAAAESAAAEPAKTEAPAAEPETKPIEAAPTPVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.2
5 0.2
6 0.21
7 0.19
8 0.25
9 0.23
10 0.23
11 0.23
12 0.22
13 0.22
14 0.21
15 0.21
16 0.15
17 0.15
18 0.17
19 0.17
20 0.17
21 0.17
22 0.18
23 0.18
24 0.2
25 0.21
26 0.19
27 0.17
28 0.15
29 0.14
30 0.12
31 0.11
32 0.07
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.14
41 0.17
42 0.17
43 0.16
44 0.17
45 0.21
46 0.23
47 0.21
48 0.15
49 0.13
50 0.14
51 0.14
52 0.13
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.12
61 0.13
62 0.1
63 0.11
64 0.12
65 0.12
66 0.12
67 0.15
68 0.15
69 0.16
70 0.17
71 0.16
72 0.17
73 0.17
74 0.16
75 0.13
76 0.13
77 0.1
78 0.1
79 0.12
80 0.09
81 0.14
82 0.21
83 0.26
84 0.32
85 0.39
86 0.44
87 0.48
88 0.56
89 0.56
90 0.55
91 0.56
92 0.55
93 0.5
94 0.45
95 0.44
96 0.42
97 0.41
98 0.36
99 0.32
100 0.33
101 0.35
102 0.39
103 0.38
104 0.38
105 0.44
106 0.52
107 0.58
108 0.6
109 0.67
110 0.72
111 0.78
112 0.81
113 0.76
114 0.75
115 0.74
116 0.7
117 0.68
118 0.6
119 0.57
120 0.49
121 0.46
122 0.4
123 0.32
124 0.26
125 0.19
126 0.19
127 0.14
128 0.13
129 0.12
130 0.15
131 0.15
132 0.14
133 0.15
134 0.12
135 0.13
136 0.13
137 0.12
138 0.11
139 0.11
140 0.11
141 0.12
142 0.11
143 0.08
144 0.07
145 0.07
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.07
160 0.07
161 0.06
162 0.07
163 0.08
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.05
171 0.05
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.08
178 0.08
179 0.08
180 0.07
181 0.07
182 0.09
183 0.09
184 0.11
185 0.11
186 0.11
187 0.12
188 0.17
189 0.17
190 0.17
191 0.26
192 0.3
193 0.37
194 0.4
195 0.48
196 0.52
197 0.61
198 0.66
199 0.67
200 0.67
201 0.63
202 0.67
203 0.68
204 0.66
205 0.65
206 0.64
207 0.62
208 0.63
209 0.62
210 0.61
211 0.59
212 0.53
213 0.49
214 0.46
215 0.42
216 0.4
217 0.39
218 0.42
219 0.41
220 0.41
221 0.46
222 0.48
223 0.52
224 0.56
225 0.65
226 0.66
227 0.66
228 0.65
229 0.62
230 0.6
231 0.57
232 0.53
233 0.49
234 0.46
235 0.46
236 0.47
237 0.42
238 0.39
239 0.34
240 0.29
241 0.23
242 0.17
243 0.12
244 0.1
245 0.09
246 0.08
247 0.11
248 0.12
249 0.09
250 0.1
251 0.1
252 0.12
253 0.12
254 0.12
255 0.1
256 0.09
257 0.1
258 0.08
259 0.07
260 0.06
261 0.07
262 0.08
263 0.07
264 0.06
265 0.06
266 0.08
267 0.09
268 0.08
269 0.09
270 0.08
271 0.11
272 0.15
273 0.19
274 0.25
275 0.24
276 0.28
277 0.32
278 0.31
279 0.29
280 0.26
281 0.27
282 0.2
283 0.23
284 0.21
285 0.18